BLASTX nr result
ID: Phellodendron21_contig00025696
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025696 (553 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011098260.1 PREDICTED: uncharacterized protein LOC105176954 i... 69 2e-10 XP_011098252.1 PREDICTED: uncharacterized protein LOC105176954 i... 69 2e-10 XP_015583293.1 PREDICTED: uncharacterized protein LOC8270689 iso... 68 5e-10 XP_012092082.1 PREDICTED: uncharacterized protein LOC105649774 i... 68 5e-10 XP_002307091.1 hypothetical protein POPTR_0005s07790g [Populus t... 68 5e-10 XP_011022785.1 PREDICTED: uncharacterized protein LOC105124457 i... 68 5e-10 XP_007047977.1 PREDICTED: uncharacterized protein LOC18611578 is... 68 5e-10 EEF29179.1 heat shock protein 70 (HSP70)-interacting protein, pu... 68 5e-10 XP_002533208.2 PREDICTED: uncharacterized protein LOC8270689 iso... 68 5e-10 XP_012091974.1 PREDICTED: uncharacterized protein LOC105649774 i... 68 5e-10 OAY33177.1 hypothetical protein MANES_13G075400 [Manihot esculenta] 68 5e-10 XP_011031003.1 PREDICTED: uncharacterized protein LOC105130276 i... 68 5e-10 XP_011022784.1 PREDICTED: uncharacterized protein LOC105124457 i... 68 5e-10 XP_006380423.1 hypothetical protein POPTR_0007s05550g [Populus t... 68 5e-10 XP_017969438.1 PREDICTED: uncharacterized protein LOC18611578 is... 68 5e-10 XP_011031002.1 PREDICTED: uncharacterized protein LOC105130276 i... 68 5e-10 OMP04095.1 Armadillo-like helical [Corchorus olitorius] 68 5e-10 OAY35852.1 hypothetical protein MANES_12G135800 [Manihot esculenta] 68 5e-10 CAN77716.1 hypothetical protein VITISV_023407 [Vitis vinifera] 68 5e-10 OMO56071.1 ABC transporter-like protein [Corchorus capsularis] 68 6e-10 >XP_011098260.1 PREDICTED: uncharacterized protein LOC105176954 isoform X2 [Sesamum indicum] Length = 619 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 462 LNMDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 ++MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MSMDKVSPDCPYPGCFFCVMKEGNPSKRRA 30 >XP_011098252.1 PREDICTED: uncharacterized protein LOC105176954 isoform X1 [Sesamum indicum] Length = 623 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 462 LNMDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 ++MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MSMDKVSPDCPYPGCFFCVMKEGNPSKRRA 30 >XP_015583293.1 PREDICTED: uncharacterized protein LOC8270689 isoform X2 [Ricinus communis] Length = 617 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_012092082.1 PREDICTED: uncharacterized protein LOC105649774 isoform X2 [Jatropha curcas] Length = 618 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_002307091.1 hypothetical protein POPTR_0005s07790g [Populus trichocarpa] EEE94087.1 hypothetical protein POPTR_0005s07790g [Populus trichocarpa] Length = 618 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_011022785.1 PREDICTED: uncharacterized protein LOC105124457 isoform X2 [Populus euphratica] Length = 619 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_007047977.1 PREDICTED: uncharacterized protein LOC18611578 isoform X2 [Theobroma cacao] EOX92134.1 ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 2 [Theobroma cacao] Length = 621 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >EEF29179.1 heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 627 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_002533208.2 PREDICTED: uncharacterized protein LOC8270689 isoform X1 [Ricinus communis] Length = 628 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_012091974.1 PREDICTED: uncharacterized protein LOC105649774 isoform X1 [Jatropha curcas] KDP46848.1 hypothetical protein JCGZ_24057 [Jatropha curcas] Length = 629 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >OAY33177.1 hypothetical protein MANES_13G075400 [Manihot esculenta] Length = 630 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_011031003.1 PREDICTED: uncharacterized protein LOC105130276 isoform X2 [Populus euphratica] XP_011031004.1 PREDICTED: uncharacterized protein LOC105130276 isoform X3 [Populus euphratica] Length = 630 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_011022784.1 PREDICTED: uncharacterized protein LOC105124457 isoform X1 [Populus euphratica] Length = 630 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_006380423.1 hypothetical protein POPTR_0007s05550g [Populus trichocarpa] ERP58220.1 hypothetical protein POPTR_0007s05550g [Populus trichocarpa] Length = 630 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_017969438.1 PREDICTED: uncharacterized protein LOC18611578 isoform X1 [Theobroma cacao] EOX92133.1 ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 1 [Theobroma cacao] Length = 630 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >XP_011031002.1 PREDICTED: uncharacterized protein LOC105130276 isoform X1 [Populus euphratica] Length = 631 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >OMP04095.1 Armadillo-like helical [Corchorus olitorius] Length = 635 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >OAY35852.1 hypothetical protein MANES_12G135800 [Manihot esculenta] Length = 635 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >CAN77716.1 hypothetical protein VITISV_023407 [Vitis vinifera] Length = 635 Score = 67.8 bits (164), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28 >OMO56071.1 ABC transporter-like protein [Corchorus capsularis] Length = 1945 Score = 67.8 bits (164), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 468 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 551 MDKVSPDCPYPGCFFCVMKEGNPSKRRA Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRA 28