BLASTX nr result
ID: Phellodendron21_contig00025547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025547 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO75812.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] 164 4e-49 KDO75811.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] 164 1e-48 KDO75810.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] 164 2e-48 XP_006449264.1 hypothetical protein CICLE_v10015451mg [Citrus cl... 164 3e-48 XP_006449259.1 hypothetical protein CICLE_v10015451mg [Citrus cl... 164 3e-48 KDO75805.1 hypothetical protein CISIN_1g015555mg [Citrus sinensi... 164 3e-48 XP_006449260.1 hypothetical protein CICLE_v10015451mg [Citrus cl... 164 3e-48 XP_006467869.1 PREDICTED: uncharacterized protein LOC102620672 i... 164 1e-47 XP_006449262.1 hypothetical protein CICLE_v10015451mg [Citrus cl... 164 1e-47 XP_006467868.1 PREDICTED: uncharacterized protein LOC102620672 i... 164 1e-47 XP_006449263.1 hypothetical protein CICLE_v10015451mg [Citrus cl... 164 1e-47 XP_016710947.1 PREDICTED: uncharacterized protein LOC107924884 [... 155 2e-44 KHG08288.1 hypothetical protein F383_16150 [Gossypium arboreum] 154 4e-44 XP_012455069.1 PREDICTED: uncharacterized protein LOC105776743 [... 155 5e-44 OMO76579.1 hypothetical protein CCACVL1_15608 [Corchorus capsula... 155 6e-44 OMO65071.1 hypothetical protein COLO4_31547 [Corchorus olitorius] 155 6e-44 XP_017649455.1 PREDICTED: uncharacterized protein LOC108489422 [... 154 7e-44 KCW44964.1 hypothetical protein EUGRSUZ_L01443 [Eucalyptus grandis] 149 2e-43 XP_016726228.1 PREDICTED: uncharacterized protein LOC107937770 [... 153 2e-43 XP_010040735.2 PREDICTED: uncharacterized protein LOC104429587 [... 149 3e-43 >KDO75812.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] Length = 269 Score = 164 bits (416), Expect = 4e-49 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >KDO75811.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] Length = 310 Score = 164 bits (416), Expect = 1e-48 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >KDO75810.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] Length = 332 Score = 164 bits (416), Expect = 2e-48 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006449264.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] ESR62504.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] Length = 347 Score = 164 bits (416), Expect = 3e-48 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006449259.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] ESR62499.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] Length = 349 Score = 164 bits (416), Expect = 3e-48 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >KDO75805.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] KDO75806.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] KDO75807.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] KDO75808.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] KDO75809.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] Length = 350 Score = 164 bits (416), Expect = 3e-48 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006449260.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] ESR62500.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] Length = 350 Score = 164 bits (416), Expect = 3e-48 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006467869.1 PREDICTED: uncharacterized protein LOC102620672 isoform X2 [Citrus sinensis] KDO75802.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] Length = 402 Score = 164 bits (416), Expect = 1e-47 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006449262.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] ESR62502.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] Length = 402 Score = 164 bits (416), Expect = 1e-47 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006467868.1 PREDICTED: uncharacterized protein LOC102620672 isoform X1 [Citrus sinensis] KDO75803.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] KDO75804.1 hypothetical protein CISIN_1g015555mg [Citrus sinensis] Length = 405 Score = 164 bits (416), Expect = 1e-47 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_006449263.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] ESR62503.1 hypothetical protein CICLE_v10015451mg [Citrus clementina] Length = 405 Score = 164 bits (416), Expect = 1e-47 Identities = 76/83 (91%), Positives = 79/83 (95%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVENFDP+RYLEIVKSEGFEISQPALDPNST IHHK T Sbjct: 175 KRFLHPDVVSNYDYIFLWDEDLGVENFDPRRYLEIVKSEGFEISQPALDPNSTEIHHKFT 234 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RGSVKCTN Sbjct: 235 IRARTKKFHRRVYDLRGSVKCTN 257 >XP_016710947.1 PREDICTED: uncharacterized protein LOC107924884 [Gossypium hirsutum] XP_016710948.1 PREDICTED: uncharacterized protein LOC107924884 [Gossypium hirsutum] Length = 360 Score = 155 bits (391), Expect = 2e-44 Identities = 69/83 (83%), Positives = 76/83 (91%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPD+VS YDY+FLWDEDLGVE+FDP RYLEIVKSEG EISQPALDPNST IHH++T Sbjct: 176 KRFLHPDIVSVYDYIFLWDEDLGVEHFDPTRYLEIVKSEGLEISQPALDPNSTEIHHRIT 235 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RG KC+N Sbjct: 236 IRARTKKFHRRVYDLRGKTKCSN 258 >KHG08288.1 hypothetical protein F383_16150 [Gossypium arboreum] Length = 371 Score = 154 bits (390), Expect = 4e-44 Identities = 68/83 (81%), Positives = 76/83 (91%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPD+VS YDY+FLWDEDLGVE+FDP RYLEIVKSEG EISQPALDPNST IHH++T Sbjct: 176 KRFLHPDIVSVYDYIFLWDEDLGVEHFDPTRYLEIVKSEGLEISQPALDPNSTEIHHRIT 235 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRR+YD+RG KC+N Sbjct: 236 IRARTKKFHRRIYDLRGKTKCSN 258 >XP_012455069.1 PREDICTED: uncharacterized protein LOC105776743 [Gossypium raimondii] XP_012455071.1 PREDICTED: uncharacterized protein LOC105776743 [Gossypium raimondii] KJB69437.1 hypothetical protein B456_011G024200 [Gossypium raimondii] KJB69438.1 hypothetical protein B456_011G024200 [Gossypium raimondii] Length = 400 Score = 155 bits (391), Expect = 5e-44 Identities = 69/83 (83%), Positives = 76/83 (91%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPD+VS YDY+FLWDEDLGVE+FDP RYLEIVKSEG EISQPALDPNST IHH++T Sbjct: 176 KRFLHPDIVSVYDYIFLWDEDLGVEHFDPTRYLEIVKSEGLEISQPALDPNSTEIHHRIT 235 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RG KC+N Sbjct: 236 IRARTKKFHRRVYDLRGKTKCSN 258 >OMO76579.1 hypothetical protein CCACVL1_15608 [Corchorus capsularis] Length = 408 Score = 155 bits (391), Expect = 6e-44 Identities = 69/83 (83%), Positives = 77/83 (92%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVE+FDP+RYL+IVKSEG EISQPALDPNST IHH++T Sbjct: 177 KRFLHPDVVSIYDYIFLWDEDLGVEHFDPERYLKIVKSEGLEISQPALDPNSTEIHHRIT 236 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR K+FHRRVYD+RG KCTN Sbjct: 237 IRARTKRFHRRVYDLRGKTKCTN 259 >OMO65071.1 hypothetical protein COLO4_31547 [Corchorus olitorius] Length = 408 Score = 155 bits (391), Expect = 6e-44 Identities = 69/83 (83%), Positives = 77/83 (92%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPDVVS YDY+FLWDEDLGVE+FDP+RYL+IVKSEG EISQPALDPNST IHH++T Sbjct: 177 KRFLHPDVVSIYDYIFLWDEDLGVEHFDPERYLKIVKSEGLEISQPALDPNSTEIHHRIT 236 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR K+FHRRVYD+RG KCTN Sbjct: 237 IRARTKRFHRRVYDLRGKTKCTN 259 >XP_017649455.1 PREDICTED: uncharacterized protein LOC108489422 [Gossypium arboreum] XP_017649456.1 PREDICTED: uncharacterized protein LOC108489422 [Gossypium arboreum] Length = 400 Score = 154 bits (390), Expect = 7e-44 Identities = 68/83 (81%), Positives = 76/83 (91%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPD+VS YDY+FLWDEDLGVE+FDP RYLEIVKSEG EISQPALDPNST IHH++T Sbjct: 176 KRFLHPDIVSVYDYIFLWDEDLGVEHFDPTRYLEIVKSEGLEISQPALDPNSTEIHHRIT 235 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRR+YD+RG KC+N Sbjct: 236 IRARTKKFHRRIYDLRGKTKCSN 258 >KCW44964.1 hypothetical protein EUGRSUZ_L01443 [Eucalyptus grandis] Length = 249 Score = 149 bits (377), Expect = 2e-43 Identities = 67/83 (80%), Positives = 74/83 (89%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHP +VS YDY+FLWDEDLGV+NF P RYL+IVKSEG EISQPAL PNST IHH++T Sbjct: 36 KRFLHPSIVSAYDYIFLWDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRIT 95 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IR+R KKFHRRVYDVRGS KCTN Sbjct: 96 IRSRTKKFHRRVYDVRGSTKCTN 118 >XP_016726228.1 PREDICTED: uncharacterized protein LOC107937770 [Gossypium hirsutum] XP_016726229.1 PREDICTED: uncharacterized protein LOC107937770 [Gossypium hirsutum] Length = 400 Score = 153 bits (387), Expect = 2e-43 Identities = 68/83 (81%), Positives = 76/83 (91%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHPD+VS YDY+FLWDEDLGVE+FDP RYLEIV+SEG EISQPALDPNST IHH++T Sbjct: 176 KRFLHPDIVSVYDYIFLWDEDLGVEHFDPTRYLEIVESEGLEISQPALDPNSTEIHHRIT 235 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IRAR KKFHRRVYD+RG KC+N Sbjct: 236 IRARTKKFHRRVYDLRGKTKCSN 258 >XP_010040735.2 PREDICTED: uncharacterized protein LOC104429587 [Eucalyptus grandis] Length = 270 Score = 149 bits (377), Expect = 3e-43 Identities = 67/83 (80%), Positives = 74/83 (89%) Frame = -1 Query: 251 KRFLHPDVVSTYDYVFLWDEDLGVENFDPQRYLEIVKSEGFEISQPALDPNSTGIHHKVT 72 KRFLHP +VS YDY+FLWDEDLGV+NF P RYL+IVKSEG EISQPAL PNST IHH++T Sbjct: 36 KRFLHPSIVSAYDYIFLWDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRIT 95 Query: 71 IRARAKKFHRRVYDVRGSVKCTN 3 IR+R KKFHRRVYDVRGS KCTN Sbjct: 96 IRSRTKKFHRRVYDVRGSTKCTN 118