BLASTX nr result
ID: Phellodendron21_contig00025479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025479 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006452643.1 hypothetical protein CICLE_v10009293mg [Citrus cl... 71 9e-13 >XP_006452643.1 hypothetical protein CICLE_v10009293mg [Citrus clementina] ESR65883.1 hypothetical protein CICLE_v10009293mg [Citrus clementina] KDO59189.1 hypothetical protein CISIN_1g018875mg [Citrus sinensis] Length = 247 Score = 70.9 bits (172), Expect = 9e-13 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -1 Query: 290 IDMDGNQVSLLGWSPVNQLLKRYLFIINLALLISLFTLWIYQPVVVYSI 144 IDM G QVSL+GWSPVNQLLK YLFI+ LL+ LF L IYQP +VYSI Sbjct: 171 IDMAGTQVSLIGWSPVNQLLKGYLFIVYNVLLLFLFALRIYQPRIVYSI 219