BLASTX nr result
ID: Phellodendron21_contig00025416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025416 (1240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNF01616.1 hypothetical protein PSTG_05048 [Puccinia striiformis... 62 6e-07 XP_003330118.1 hypothetical protein PGTG_11028 [Puccinia gramini... 60 3e-06 >KNF01616.1 hypothetical protein PSTG_05048 [Puccinia striiformis f. sp. tritici PST-78] Length = 416 Score = 62.4 bits (150), Expect = 6e-07 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 82 KRRKGLAGSIIGTALDVAIDAAIFTSAVGYAAFQIWRGKPLDE 210 KRRKG+AG+I+ TALD AA+FTSA+GYAA+Q WRGK LDE Sbjct: 95 KRRKGVAGAILSTALD----AALFTSAIGYAAYQFWRGKDLDE 133 >XP_003330118.1 hypothetical protein PGTG_11028 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP85699.1 hypothetical protein PGTG_11028 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 360 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 82 KRRKGLAGSIIGTALDVAIDAAIFTSAVGYAAFQIWRGKPLDE 210 KRRKG+AG+I+ TALD AA+FTSA+GYAA+Q W GKPL++ Sbjct: 62 KRRKGVAGAILSTALD----AALFTSAIGYAAYQFWCGKPLEQ 100