BLASTX nr result
ID: Phellodendron21_contig00025209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025209 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015389660.1 PREDICTED: syntaxin-71 isoform X3 [Citrus sinensis] 56 4e-07 >XP_015389660.1 PREDICTED: syntaxin-71 isoform X3 [Citrus sinensis] Length = 254 Score = 55.8 bits (133), Expect = 4e-07 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = +3 Query: 3 DEIDEKVDRATSDLKSTNLRLKNTVN---TVMLVFKQRFHD 116 DEIDEKVDRATSDLKSTN+RLK+T+ VMLVFKQ D Sbjct: 211 DEIDEKVDRATSDLKSTNVRLKDTLTQCVKVMLVFKQHLPD 251