BLASTX nr result
ID: Phellodendron21_contig00025144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025144 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416851.1 hypothetical protein MELLADRAFT_94027 [Melampsora... 60 9e-08 OAV97864.1 hypothetical protein PTTG_07309 [Puccinia triticina 1... 55 7e-06 >XP_007416851.1 hypothetical protein MELLADRAFT_94027 [Melampsora larici-populina 98AG31] EGF99874.1 hypothetical protein MELLADRAFT_94027 [Melampsora larici-populina 98AG31] Length = 682 Score = 60.5 bits (145), Expect = 9e-08 Identities = 24/53 (45%), Positives = 36/53 (67%) Frame = +2 Query: 77 AHKLVGHGVIWIYTFCCGSGPNRWKRLGILGYWAVCLSSGVGGWSSYLMRKRR 235 + K +G+G+ W +FC WKRL I+GYW CL G+GGW++YL++K+R Sbjct: 329 SEKFLGNGLNWFLSFCFVD----WKRLAIMGYWISCLIIGIGGWTTYLIKKKR 377 >OAV97864.1 hypothetical protein PTTG_07309 [Puccinia triticina 1-1 BBBD Race 1] Length = 966 Score = 55.1 bits (131), Expect = 7e-06 Identities = 21/43 (48%), Positives = 31/43 (72%) Frame = +2 Query: 143 RWKRLGILGYWAVCLSSGVGGWSSYLMRKRRACNGSKKPPTNI 271 RW R+ +L YW +CL + +GGW+SYL+RKRR+ S + P+ I Sbjct: 506 RWTRIAMLVYWWICLVAAIGGWTSYLVRKRRSLRNSHRIPSEI 548