BLASTX nr result
ID: Phellodendron21_contig00025122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025122 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016464657.1 PREDICTED: ATP-citrate synthase alpha chain prote... 65 3e-10 ERN02340.1 hypothetical protein AMTR_s00096p00027330 [Amborella ... 60 9e-10 OAY32559.1 hypothetical protein MANES_13G027700 [Manihot esculenta] 63 4e-09 XP_011086595.1 PREDICTED: ATP-citrate synthase alpha chain prote... 63 4e-09 XP_011071109.1 PREDICTED: ATP-citrate synthase alpha chain prote... 63 4e-09 CDP13187.1 unnamed protein product [Coffea canephora] 63 4e-09 XP_012848161.1 PREDICTED: ATP-citrate synthase alpha chain prote... 63 4e-09 XP_008340063.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 8e-09 KDO82338.1 hypothetical protein CISIN_1g014493mg [Citrus sinensi... 62 8e-09 XP_002525398.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 8e-09 XP_006438324.1 hypothetical protein CICLE_v10031633mg [Citrus cl... 62 8e-09 XP_004297395.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 8e-09 XP_016457452.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 9e-09 XP_018625574.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 1e-08 XP_009799582.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 1e-08 OAY63180.1 ATP-citrate synthase alpha chain protein 2 [Ananas co... 62 1e-08 XP_020088338.1 ATP-citrate synthase alpha chain protein 1 [Anana... 62 1e-08 GAV70610.1 ATP-grasp_2 domain-containing protein [Cephalotus fol... 62 1e-08 XP_019160901.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 1e-08 XP_019233675.1 PREDICTED: ATP-citrate synthase alpha chain prote... 62 1e-08 >XP_016464657.1 PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Nicotiana tabacum] Length = 225 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAIGCI+AAA Sbjct: 195 EEIGIPIEVYGPEATMTGICKQAIGCITAAA 225 >ERN02340.1 hypothetical protein AMTR_s00096p00027330 [Amborella trichopoda] Length = 68 Score = 60.5 bits (145), Expect = 9e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIP+EVYGPEATMTGICK+AI CI+AAA Sbjct: 38 EEIGIPLEVYGPEATMTGICKEAIDCITAAA 68 >OAY32559.1 hypothetical protein MANES_13G027700 [Manihot esculenta] Length = 423 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECISAAA 423 >XP_011086595.1 PREDICTED: ATP-citrate synthase alpha chain protein 1-like [Sesamum indicum] Length = 423 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECISAAA 423 >XP_011071109.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Sesamum indicum] Length = 423 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECISAAA 423 >CDP13187.1 unnamed protein product [Coffea canephora] Length = 423 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECISAAA 423 >XP_012848161.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 [Erythranthe guttata] EYU28438.1 hypothetical protein MIMGU_mgv1a006998mg [Erythranthe guttata] Length = 423 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECISAAA 423 >XP_008340063.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Malus domestica] XP_008340065.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Malus domestica] Length = 423 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIG+PIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGLPIEVYGPEATMTGICKQAIQCISAAA 423 >KDO82338.1 hypothetical protein CISIN_1g014493mg [Citrus sinensis] KDO82339.1 hypothetical protein CISIN_1g014493mg [Citrus sinensis] Length = 423 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIG+PIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGLPIEVYGPEATMTGICKQAIECISAAA 423 >XP_002525398.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Ricinus communis] EEF37036.1 ATP-citrate synthase, putative [Ricinus communis] Length = 423 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIDCITAAA 423 >XP_006438324.1 hypothetical protein CICLE_v10031633mg [Citrus clementina] XP_006438325.1 hypothetical protein CICLE_v10031633mg [Citrus clementina] XP_006483902.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Citrus sinensis] XP_006483903.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Citrus sinensis] ESR51564.1 hypothetical protein CICLE_v10031633mg [Citrus clementina] ESR51565.1 hypothetical protein CICLE_v10031633mg [Citrus clementina] Length = 423 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIG+PIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGLPIEVYGPEATMTGICKQAIECISAAA 423 >XP_004297395.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Fragaria vesca subsp. vesca] Length = 423 Score = 62.4 bits (150), Expect = 8e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIG+PIEVYGPEATMTGICKQAI CISAAA Sbjct: 393 EEIGLPIEVYGPEATMTGICKQAIQCISAAA 423 >XP_016457452.1 PREDICTED: ATP-citrate synthase alpha chain protein 1-like, partial [Nicotiana tabacum] Length = 301 Score = 62.0 bits (149), Expect = 9e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 271 EEIGIPIEVYGPEATMTGICKQAIECITAAA 301 >XP_018625574.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X2 [Nicotiana tomentosiformis] Length = 363 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 333 EEIGIPIEVYGPEATMTGICKQAIECITAAA 363 >XP_009799582.1 PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X2 [Nicotiana sylvestris] Length = 363 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 333 EEIGIPIEVYGPEATMTGICKQAIECITAAA 363 >OAY63180.1 ATP-citrate synthase alpha chain protein 2 [Ananas comosus] Length = 416 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 386 EEIGIPIEVYGPEATMTGICKQAIECITAAA 416 >XP_020088338.1 ATP-citrate synthase alpha chain protein 1 [Ananas comosus] XP_020088339.1 ATP-citrate synthase alpha chain protein 1 [Ananas comosus] Length = 423 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECITAAA 423 >GAV70610.1 ATP-grasp_2 domain-containing protein [Cephalotus follicularis] Length = 423 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECITAAA 423 >XP_019160901.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Ipomoea nil] XP_019160902.1 PREDICTED: ATP-citrate synthase alpha chain protein 1 [Ipomoea nil] Length = 423 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECITAAA 423 >XP_019233675.1 PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Nicotiana attenuata] OIT27225.1 atp-citrate synthase alpha chain protein 2 [Nicotiana attenuata] Length = 423 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 393 EEIGIPIEVYGPEATMTGICKQAIGCISAAA 301 EEIGIPIEVYGPEATMTGICKQAI CI+AAA Sbjct: 393 EEIGIPIEVYGPEATMTGICKQAIECITAAA 423