BLASTX nr result
ID: Phellodendron21_contig00024994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024994 (538 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006445747.1 hypothetical protein CICLE_v10016593mg [Citrus cl... 70 1e-11 GAV76820.1 MMtag domain-containing protein [Cephalotus follicula... 57 8e-07 >XP_006445747.1 hypothetical protein CICLE_v10016593mg [Citrus clementina] XP_006485184.1 PREDICTED: multiple myeloma tumor-associated protein 2 homolog [Citrus sinensis] ESR58987.1 hypothetical protein CICLE_v10016593mg [Citrus clementina] KDO44430.1 hypothetical protein CISIN_1g027359mg [Citrus sinensis] Length = 224 Score = 70.5 bits (171), Expect = 1e-11 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -1 Query: 538 AWVHGLGFSRGAP-RPWEDPNTLQSGPDEVSPDEMEKASVPSPPQNI 401 AWVHGLGFSRGA RPWEDP TLQSGP+EVS ++ + A PPQNI Sbjct: 124 AWVHGLGFSRGAASRPWEDPRTLQSGPEEVSTEKEKPAVASPPPQNI 170 >GAV76820.1 MMtag domain-containing protein [Cephalotus follicularis] Length = 223 Score = 57.4 bits (137), Expect = 8e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -1 Query: 538 AWVHGLGFSRGAPRPWEDPNTLQSGPDEVSPDEMEKASVPSPPQN 404 AWVHG+GFSR APRPWE+P+TL+S EVSP+ ++ A P +N Sbjct: 123 AWVHGIGFSR-APRPWEEPSTLKSSQKEVSPETVKVALPPPSTKN 166