BLASTX nr result
ID: Phellodendron21_contig00024976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024976 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006472359.1 PREDICTED: ribosomal RNA processing protein 1 hom... 70 2e-12 XP_006433696.1 hypothetical protein CICLE_v10002567mg [Citrus cl... 70 2e-12 >XP_006472359.1 PREDICTED: ribosomal RNA processing protein 1 homolog [Citrus sinensis] Length = 188 Score = 70.5 bits (171), Expect = 2e-12 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 5/49 (10%) Frame = +3 Query: 258 ICFWLLHQVKNSYDGKKA-----TIQSEVQSEHESIKLGRKDIRFPMQQ 389 ICFWLLHQV+ SYD KKA QSEV+SEHE IKLGRKD+R P+QQ Sbjct: 31 ICFWLLHQVRKSYDRKKAYEEGTATQSEVKSEHEGIKLGRKDVRLPVQQ 79 >XP_006433696.1 hypothetical protein CICLE_v10002567mg [Citrus clementina] ESR46936.1 hypothetical protein CICLE_v10002567mg [Citrus clementina] KDO81377.1 hypothetical protein CISIN_1g029466mg [Citrus sinensis] Length = 193 Score = 70.5 bits (171), Expect = 2e-12 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 5/49 (10%) Frame = +3 Query: 258 ICFWLLHQVKNSYDGKKA-----TIQSEVQSEHESIKLGRKDIRFPMQQ 389 ICFWLLHQV+ SYD KKA QSEV+SEHE IKLGRKD+R P+QQ Sbjct: 31 ICFWLLHQVRKSYDRKKAYEEGTATQSEVKSEHEGIKLGRKDVRLPVQQ 79