BLASTX nr result
ID: Phellodendron21_contig00024934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024934 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006452014.1 hypothetical protein CICLE_v10007969mg [Citrus cl... 61 5e-08 XP_006452013.1 hypothetical protein CICLE_v10007969mg [Citrus cl... 61 5e-08 XP_006452015.1 hypothetical protein CICLE_v10007969mg [Citrus cl... 61 5e-08 >XP_006452014.1 hypothetical protein CICLE_v10007969mg [Citrus clementina] XP_006464662.1 PREDICTED: diacylglycerol kinase 5 isoform X2 [Citrus sinensis] ESR65254.1 hypothetical protein CICLE_v10007969mg [Citrus clementina] KDO74262.1 hypothetical protein CISIN_1g009462mg [Citrus sinensis] Length = 519 Score = 60.8 bits (146), Expect = 5e-08 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Frame = -1 Query: 448 LATPCCRSRSINDTHXXXXXXXXXXXXXXXXXXXE---RRKFGAADTFKIPEEVDITQLS 278 LATPCCRSRSIND + RRKFGAADTFKIPEEVDITQLS Sbjct: 460 LATPCCRSRSINDAPSPASIIDEDCESIEDESSEDWEERRKFGAADTFKIPEEVDITQLS 519 >XP_006452013.1 hypothetical protein CICLE_v10007969mg [Citrus clementina] ESR65253.1 hypothetical protein CICLE_v10007969mg [Citrus clementina] KDO74261.1 hypothetical protein CISIN_1g009462mg [Citrus sinensis] Length = 528 Score = 60.8 bits (146), Expect = 5e-08 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Frame = -1 Query: 448 LATPCCRSRSINDTHXXXXXXXXXXXXXXXXXXXE---RRKFGAADTFKIPEEVDITQLS 278 LATPCCRSRSIND + RRKFGAADTFKIPEEVDITQLS Sbjct: 469 LATPCCRSRSINDAPSPASIIDEDCESIEDESSEDWEERRKFGAADTFKIPEEVDITQLS 528 >XP_006452015.1 hypothetical protein CICLE_v10007969mg [Citrus clementina] XP_006464661.1 PREDICTED: diacylglycerol kinase 5 isoform X1 [Citrus sinensis] ESR65255.1 hypothetical protein CICLE_v10007969mg [Citrus clementina] KDO74260.1 hypothetical protein CISIN_1g009462mg [Citrus sinensis] Length = 534 Score = 60.8 bits (146), Expect = 5e-08 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Frame = -1 Query: 448 LATPCCRSRSINDTHXXXXXXXXXXXXXXXXXXXE---RRKFGAADTFKIPEEVDITQLS 278 LATPCCRSRSIND + RRKFGAADTFKIPEEVDITQLS Sbjct: 475 LATPCCRSRSINDAPSPASIIDEDCESIEDESSEDWEERRKFGAADTFKIPEEVDITQLS 534