BLASTX nr result
ID: Phellodendron21_contig00024902
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024902 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413064.1 hypothetical protein MELLADRAFT_117286 [Melampsor... 58 2e-07 >XP_007413064.1 hypothetical protein MELLADRAFT_117286 [Melampsora larici-populina 98AG31] EGG03617.1 hypothetical protein MELLADRAFT_117286 [Melampsora larici-populina 98AG31] Length = 325 Score = 58.2 bits (139), Expect = 2e-07 Identities = 30/60 (50%), Positives = 39/60 (65%) Frame = +3 Query: 183 KSNKATLTPANRASTSTAAPQPVASNSVPKRTLLPRTKYFSVVPLHLIFTIFAIHFLPSR 362 KSNK T ++ST+T S KR+ LP TKYFS+VPLHL+FT ++IH LPS+ Sbjct: 15 KSNKNT-----QSSTTTTTTPTTNIQSTTKRSSLPITKYFSIVPLHLLFTFYSIHILPSQ 69