BLASTX nr result
ID: Phellodendron21_contig00024516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024516 (707 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003616777.1 hypothetical protein MTR_5g084150 [Medicago trunc... 99 3e-22 XP_002886862.1 hypothetical protein ARALYDRAFT_893969 [Arabidops... 70 2e-12 XP_019098150.1 PREDICTED: uncharacterized protein LOC109131543 [... 67 2e-11 XP_018515267.1 PREDICTED: uncharacterized protein LOC108872288 [... 67 2e-11 XP_019105143.1 PREDICTED: uncharacterized protein LOC109135010 [... 66 2e-11 XP_002888366.1 hypothetical protein ARALYDRAFT_894017 [Arabidops... 67 3e-11 NP_683579.1 hypothetical protein AT3G20362 [Arabidopsis thaliana... 66 5e-11 XP_010657834.1 PREDICTED: uncharacterized protein LOC104880993 [... 64 2e-10 KJB11124.1 hypothetical protein B456_001G241700 [Gossypium raimo... 62 3e-10 OMP10579.1 hypothetical protein CCACVL1_00863 [Corchorus capsula... 63 5e-10 XP_019069816.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 62 8e-10 XP_016475777.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 60 7e-09 NP_054927.1 hypothetical protein SpolCp017 (plastid) [Spinacia o... 60 1e-08 KJB68765.1 hypothetical protein B456_011G014300 [Gossypium raimo... 53 3e-08 AFK48586.1 unknown [Medicago truncatula] 58 3e-08 XP_016903654.1 PREDICTED: uncharacterized protein LOC107992272, ... 57 6e-08 XP_017183153.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 56 3e-07 OMO89202.1 hypothetical protein COLO4_19850 [Corchorus olitorius] 53 2e-06 NP_817169.1 ORF64a [Pinus koraiensis] AAO74018.1 ORF64a (chlorop... 52 1e-05 >XP_003616777.1 hypothetical protein MTR_5g084150 [Medicago truncatula] AES99735.1 hypothetical protein MTR_5g084150 [Medicago truncatula] Length = 187 Score = 99.4 bits (246), Expect = 3e-22 Identities = 53/95 (55%), Positives = 56/95 (58%) Frame = -1 Query: 377 HFWKTKGVISFHGGSADYWAELDLNQRRHIANEFTVRPH*PLGHRPRKNQV*AYLESTIN 198 HF TK VIS HGGS ++WAELDLNQRRHIANEFT Sbjct: 4 HFKNTKWVISLHGGSVNFWAELDLNQRRHIANEFT------------------------- 38 Query: 197 FLS*YPTPRGSRIPAASLKERCPEPLDDGGILARL 93 YPTPRGSRIP ASLKERCP+PLDDG RL Sbjct: 39 ----YPTPRGSRIPVASLKERCPKPLDDGDEFLRL 69 >XP_002886862.1 hypothetical protein ARALYDRAFT_893969 [Arabidopsis lyrata subsp. lyrata] EFH63121.1 hypothetical protein ARALYDRAFT_893969 [Arabidopsis lyrata subsp. lyrata] Length = 63 Score = 69.7 bits (169), Expect = 2e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 65 KKLFILSMMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 KK + MMAV QVCPHRLVVQDISLSRRQRGFDFPWG Sbjct: 26 KKRIYICMMAVEQVCPHRLVVQDISLSRRQRGFDFPWG 63 >XP_019098150.1 PREDICTED: uncharacterized protein LOC109131543 [Camelina sativa] Length = 47 Score = 67.0 bits (162), Expect = 2e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 80 LSMMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 + MMAV QVCPHRLVVQDISLSRRQRGFDFPWG Sbjct: 15 IPMMAVEQVCPHRLVVQDISLSRRQRGFDFPWG 47 >XP_018515267.1 PREDICTED: uncharacterized protein LOC108872288 [Brassica rapa] Length = 31 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 86 MMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 MMAV QVCPHRLVVQDISLSRRQRGFDFPWG Sbjct: 1 MMAVEQVCPHRLVVQDISLSRRQRGFDFPWG 31 >XP_019105143.1 PREDICTED: uncharacterized protein LOC109135010 [Beta vulgaris subsp. vulgaris] Length = 31 Score = 66.2 bits (160), Expect = 2e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 86 MMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 MMAVG VCPHRL VQDISLSRRQRGFDFPWG Sbjct: 1 MMAVGHVCPHRLAVQDISLSRRQRGFDFPWG 31 >XP_002888366.1 hypothetical protein ARALYDRAFT_894017 [Arabidopsis lyrata subsp. lyrata] EFH64625.1 hypothetical protein ARALYDRAFT_894017 [Arabidopsis lyrata subsp. lyrata] Length = 57 Score = 66.6 bits (161), Expect = 3e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 86 MMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 MMAV QVCPHRLVVQDISLSRRQRGFDFPWG Sbjct: 27 MMAVEQVCPHRLVVQDISLSRRQRGFDFPWG 57 >NP_683579.1 hypothetical protein AT3G20362 [Arabidopsis thaliana] AEE76369.1 hypothetical protein AT3G20362 [Arabidopsis thaliana] Length = 47 Score = 65.9 bits (159), Expect = 5e-11 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 56 DNFKKLFILSMMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 +N L + MMAV QVCPHRLVVQDISLSRRQ+GFDFPWG Sbjct: 7 ENQSLLEKIPMMAVEQVCPHRLVVQDISLSRRQQGFDFPWG 47 >XP_010657834.1 PREDICTED: uncharacterized protein LOC104880993 [Vitis vinifera] Length = 31 Score = 63.5 bits (153), Expect = 2e-10 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 86 MMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 MMA+G+VCPHRLVVQDISLSRRQ GF+FPWG Sbjct: 1 MMAIGEVCPHRLVVQDISLSRRQWGFEFPWG 31 >KJB11124.1 hypothetical protein B456_001G241700 [Gossypium raimondii] Length = 56 Score = 61.6 bits (148), Expect(2) = 3e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 83 SMMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 SM+AV QVCPHRLVVQD SLSRRQ GFDFPWG Sbjct: 25 SMVAVRQVCPHRLVVQDTSLSRRQWGFDFPWG 56 Score = 31.6 bits (70), Expect(2) = 3e-10 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 36 SYHSIILTISKNCSY 80 S HSIILTISKNCSY Sbjct: 7 SSHSIILTISKNCSY 21 >OMP10579.1 hypothetical protein CCACVL1_00863 [Corchorus capsularis] OMP10826.1 hypothetical protein CCACVL1_00778 [Corchorus capsularis] Length = 30 Score = 62.8 bits (151), Expect = 5e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 89 MAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 MAV Q+CPHRL VQDISLSRRQRGFDFPWG Sbjct: 1 MAVRQICPHRLAVQDISLSRRQRGFDFPWG 30 >XP_019069816.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC109120459 [Solanum lycopersicum] Length = 39 Score = 62.4 bits (150), Expect = 8e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 83 SMMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 SMMAVGQ PHRLVV DISLSRRQRGF+FPWG Sbjct: 8 SMMAVGQAAPHRLVVXDISLSRRQRGFEFPWG 39 >XP_016475777.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC107797405 [Nicotiana tabacum] XP_018627300.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC108945671 [Nicotiana tomentosiformis] Length = 31 Score = 59.7 bits (143), Expect = 7e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 86 MMAVGQVCPHRLVVQDISLSRRQRGFDFPWG 178 MMAVGQ PHRLVV DISLSRRQRGF+FPWG Sbjct: 1 MMAVGQAGPHRLVVXDISLSRRQRGFEFPWG 31 >NP_054927.1 hypothetical protein SpolCp017 (plastid) [Spinacia oleracea] CAB88720.1 hypothetical protein (chloroplast) [Spinacia oleracea] Length = 83 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 246 MPERLMGTDCKFVGNMSTLVQIQLGPII 329 MPERLMGTDCKFVGNMSTLVQIQLGPII Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPII 28 >KJB68765.1 hypothetical protein B456_011G014300 [Gossypium raimondii] Length = 54 Score = 53.1 bits (126), Expect(3) = 3e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 83 SMMAVGQVCPHRLVVQDISLSRRQRGFDFP 172 SM+AV QVCPHRL VQD SLSRRQ+GF+FP Sbjct: 25 SMVAVRQVCPHRLAVQDTSLSRRQQGFNFP 54 Score = 31.6 bits (70), Expect(3) = 3e-08 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 36 SYHSIILTISKNCSY 80 S HSIILTISKNCSY Sbjct: 7 SSHSIILTISKNCSY 21 Score = 21.2 bits (43), Expect(3) = 3e-08 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +1 Query: 13 VERAFRSSHTILL 51 +E+AF SSH+I+L Sbjct: 1 MEKAFGSSHSIIL 13 >AFK48586.1 unknown [Medicago truncatula] Length = 29 Score = 57.8 bits (138), Expect = 3e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 246 MPERLMGTDCKFVGNMSTLVQIQLGPII 329 MPERLMGTDCKFVGNMSTLVQIQLGP I Sbjct: 1 MPERLMGTDCKFVGNMSTLVQIQLGPKI 28 >XP_016903654.1 PREDICTED: uncharacterized protein LOC107992272, partial [Cucumis melo] Length = 24 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 107 CPHRLVVQDISLSRRQRGFDFPWG 178 CPHRLVVQDISLSRRQRGFDFPWG Sbjct: 1 CPHRLVVQDISLSRRQRGFDFPWG 24 >XP_017183153.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC108171481 [Malus domestica] Length = 50 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 89 MAVGQVCPHRLVVQDISLSRRQRGFDFPW 175 MAV VCPHRL V DISLSRRQRGFDFPW Sbjct: 1 MAVMXVCPHRLAVXDISLSRRQRGFDFPW 29 >OMO89202.1 hypothetical protein COLO4_19850 [Corchorus olitorius] Length = 30 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 89 MAVGQVCPHRLVVQDISLSRRQRGFDFP 172 MAV Q+CPHRL VQDISLSRRQRGFD P Sbjct: 1 MAVRQICPHRLAVQDISLSRRQRGFDAP 28 >NP_817169.1 ORF64a [Pinus koraiensis] AAO74018.1 ORF64a (chloroplast) [Pinus koraiensis] Length = 64 Score = 52.0 bits (123), Expect = 1e-05 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 231 ILPGSMPERLMGTDCKFVGNMSTLVQIQLGP 323 I+PGSMPE LM TDCK VGNM TLVQIQL P Sbjct: 17 IVPGSMPEWLMRTDCKSVGNMPTLVQIQLDP 47