BLASTX nr result
ID: Phellodendron21_contig00024323
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024323 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT73576.1 hypothetical protein g.23715, partial [Auxenochlorell... 52 3e-06 XP_011401664.1 60S ribosomal protein L35-2 [Auxenochlorella prot... 52 4e-06 KVI06949.1 Ribosomal protein L29 [Cynara cardunculus var. scolymus] 50 7e-06 XP_005649392.1 hypothetical protein COCSUDRAFT_28397 [Coccomyxa ... 50 7e-06 >JAT73576.1 hypothetical protein g.23715, partial [Auxenochlorella protothecoides] Length = 132 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 279 RRLTKHQAGIKSEKQAKRDRAFPLRKYALKA 187 RRLTKHQA K+EKQAK+D AFP RKYA+KA Sbjct: 102 RRLTKHQAAAKTEKQAKKDLAFPRRKYAVKA 132 >XP_011401664.1 60S ribosomal protein L35-2 [Auxenochlorella protothecoides] KFM28628.1 60S ribosomal protein L35-2 [Auxenochlorella protothecoides] Length = 148 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 279 RRLTKHQAGIKSEKQAKRDRAFPLRKYALKA 187 RRLTKHQA K+EKQAK+D AFP RKYA+KA Sbjct: 118 RRLTKHQAAAKTEKQAKKDLAFPRRKYAVKA 148 >KVI06949.1 Ribosomal protein L29 [Cynara cardunculus var. scolymus] Length = 123 Score = 50.4 bits (119), Expect = 7e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -1 Query: 279 RRLTKHQAGIKSEKQAKRDRAFPLRKYALKA 187 RRLTKHQA +K+E++ K+D+ FPLRKYA+KA Sbjct: 93 RRLTKHQASLKTEREKKKDKYFPLRKYAIKA 123 >XP_005649392.1 hypothetical protein COCSUDRAFT_28397 [Coccomyxa subellipsoidea C-169] EIE24848.1 hypothetical protein COCSUDRAFT_28397 [Coccomyxa subellipsoidea C-169] Length = 123 Score = 50.4 bits (119), Expect = 7e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 279 RRLTKHQAGIKSEKQAKRDRAFPLRKYALKA 187 RRLTK+QA +K+EKQ K+DRAFP RK+A+KA Sbjct: 93 RRLTKYQASLKTEKQTKKDRAFPQRKFAIKA 123