BLASTX nr result
ID: Phellodendron21_contig00024206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024206 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015870433.1 PREDICTED: PTI1-like tyrosine-protein kinase At3g... 56 8e-07 >XP_015870433.1 PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Ziziphus jujuba] Length = 372 Score = 55.8 bits (133), Expect = 8e-07 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 4/44 (9%) Frame = -2 Query: 335 ENDELFKTP----HNDEKEVAEDSVDYISEEKDLKQESKEEIEP 216 ENDELFK+P +ND + AEDS D+ISEEKDLKQE KEE P Sbjct: 323 ENDELFKSPLAADYNDGQSAAEDSSDFISEEKDLKQELKEETLP 366