BLASTX nr result
ID: Phellodendron21_contig00024187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024187 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404240.1 hypothetical protein MELLADRAFT_115017 [Melampsor... 67 9e-10 OAV94871.1 hypothetical protein PTTG_26853 [Puccinia triticina 1... 63 2e-08 KNE91962.1 hypothetical protein PSTG_14632 [Puccinia striiformis... 63 2e-08 KNZ63281.1 hypothetical protein VP01_1163g1 [Puccinia sorghi] 61 7e-08 >XP_007404240.1 hypothetical protein MELLADRAFT_115017 [Melampsora larici-populina 98AG31] EGG11865.1 hypothetical protein MELLADRAFT_115017 [Melampsora larici-populina 98AG31] Length = 1109 Score = 66.6 bits (161), Expect = 9e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 503 YKLVRGFTSASVKSVVWGVDSKVVAVVTERGTHHVFAIH 387 YKLVRG+TSA V+ VVW DSK+V VVT+RGTHH+FAIH Sbjct: 491 YKLVRGYTSADVRDVVWAWDSKIVTVVTDRGTHHLFAIH 529 >OAV94871.1 hypothetical protein PTTG_26853 [Puccinia triticina 1-1 BBBD Race 1] Length = 557 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 503 YKLVRGFTSASVKSVVWGVDSKVVAVVTERGTHHVFAIH 387 YKL RGFT+A V VVW DSK+VAV+TE GTHH+FAIH Sbjct: 416 YKLARGFTAAQVADVVWRWDSKIVAVLTEHGTHHLFAIH 454 >KNE91962.1 hypothetical protein PSTG_14632 [Puccinia striiformis f. sp. tritici PST-78] Length = 1344 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 503 YKLVRGFTSASVKSVVWGVDSKVVAVVTERGTHHVFAIH 387 YKL RGFTSA V VVW DSK+V+V+TE GTHH+FAIH Sbjct: 511 YKLTRGFTSAEVTGVVWRWDSKIVSVLTEHGTHHLFAIH 549 >KNZ63281.1 hypothetical protein VP01_1163g1 [Puccinia sorghi] Length = 1318 Score = 61.2 bits (147), Expect = 7e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 503 YKLVRGFTSASVKSVVWGVDSKVVAVVTERGTHHVFAIH 387 YKL RG TSA V VVW DSK+V+V+TERGTHH+FAIH Sbjct: 501 YKLNRGITSAEVTDVVWRWDSKIVSVLTERGTHHLFAIH 539