BLASTX nr result
ID: Phellodendron21_contig00024172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024172 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO84512.1 hypothetical protein CISIN_1g035748mg [Citrus sinensis] 79 3e-14 XP_006434961.1 hypothetical protein CICLE_v10000534mg [Citrus cl... 79 3e-14 XP_006473478.1 PREDICTED: uncharacterized membrane protein At1g7... 78 1e-13 XP_018826690.1 PREDICTED: uncharacterized membrane protein At1g7... 73 6e-12 XP_018826689.1 PREDICTED: uncharacterized membrane protein At1g7... 73 6e-12 XP_010688610.1 PREDICTED: uncharacterized membrane protein At1g7... 67 4e-10 XP_016163193.1 PREDICTED: uncharacterized membrane protein At1g7... 67 4e-10 XP_015972650.1 PREDICTED: uncharacterized membrane protein At1g7... 67 4e-10 CBI19675.3 unnamed protein product, partial [Vitis vinifera] 67 4e-10 XP_010664674.2 PREDICTED: uncharacterized membrane protein At1g7... 67 4e-10 KYP72295.1 putative membrane protein At1g75140 family [Cajanus c... 67 5e-10 KHN20991.1 Putative membrane protein [Glycine soja] 65 3e-09 XP_006595940.1 PREDICTED: uncharacterized membrane protein At1g7... 65 3e-09 XP_006386930.1 hypothetical protein POPTR_0002s26370g [Populus t... 64 5e-09 XP_011006751.1 PREDICTED: uncharacterized membrane protein At1g7... 64 5e-09 XP_002510361.1 PREDICTED: uncharacterized membrane protein At1g7... 64 7e-09 KDP38483.1 hypothetical protein JCGZ_04408 [Jatropha curcas] 64 9e-09 XP_004291886.1 PREDICTED: uncharacterized membrane protein At1g7... 64 9e-09 XP_012071813.1 PREDICTED: uncharacterized membrane protein At1g7... 64 9e-09 XP_016687548.1 PREDICTED: uncharacterized membrane protein At1g7... 63 1e-08 >KDO84512.1 hypothetical protein CISIN_1g035748mg [Citrus sinensis] Length = 655 Score = 79.3 bits (194), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSSTTAATGAPIGSGAG+R FVDSSSRN DIMDLRSGG+R Sbjct: 543 DPFSSTTAATGAPIGSGAGERPFVDSSSRNADIMDLRSGGMR 584 >XP_006434961.1 hypothetical protein CICLE_v10000534mg [Citrus clementina] ESR48201.1 hypothetical protein CICLE_v10000534mg [Citrus clementina] Length = 655 Score = 79.3 bits (194), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSSTTAATGAPIGSGAG+R FVDSSSRN DIMDLRSGG+R Sbjct: 543 DPFSSTTAATGAPIGSGAGERPFVDSSSRNADIMDLRSGGMR 584 >XP_006473478.1 PREDICTED: uncharacterized membrane protein At1g75140 [Citrus sinensis] Length = 655 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSSTTAATGAPIGSGAG+R FVDSSSRN DIM+LRSGG+R Sbjct: 543 DPFSSTTAATGAPIGSGAGERPFVDSSSRNADIMELRSGGMR 584 >XP_018826690.1 PREDICTED: uncharacterized membrane protein At1g75140-like isoform X2 [Juglans regia] Length = 664 Score = 72.8 bits (177), Expect = 6e-12 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+G+G+GDRSFVDSSSR+ D+MDLR GGLR Sbjct: 549 DPFSSTSATTGAPLGTGSGDRSFVDSSSRSADMMDLRGGGLR 590 >XP_018826689.1 PREDICTED: uncharacterized membrane protein At1g75140-like isoform X1 [Juglans regia] Length = 674 Score = 72.8 bits (177), Expect = 6e-12 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+G+G+GDRSFVDSSSR+ D+MDLR GGLR Sbjct: 559 DPFSSTSATTGAPLGTGSGDRSFVDSSSRSADMMDLRGGGLR 600 >XP_010688610.1 PREDICTED: uncharacterized membrane protein At1g75140 [Beta vulgaris subsp. vulgaris] KMT02543.1 hypothetical protein BVRB_9g202300 [Beta vulgaris subsp. vulgaris] Length = 647 Score = 67.4 bits (163), Expect = 4e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPF+ST+ +GAP+GSG+GDRSF DSSSRN D+M+LR+ GLR Sbjct: 537 DPFNSTSVTSGAPLGSGSGDRSFTDSSSRNADVMELRNNGLR 578 >XP_016163193.1 PREDICTED: uncharacterized membrane protein At1g75140 [Arachis ipaensis] Length = 659 Score = 67.4 bits (163), Expect = 4e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+ SG+GDRSFVDSSSR+ ++MDLR G LR Sbjct: 544 DPFSSTSAPTGAPLASGSGDRSFVDSSSRSAEVMDLRGGPLR 585 >XP_015972650.1 PREDICTED: uncharacterized membrane protein At1g75140 [Arachis duranensis] Length = 659 Score = 67.4 bits (163), Expect = 4e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+ SG+GDRSFVDSSSR+ ++MDLR G LR Sbjct: 544 DPFSSTSAPTGAPLASGSGDRSFVDSSSRSAEVMDLRGGPLR 585 >CBI19675.3 unnamed protein product, partial [Vitis vinifera] Length = 691 Score = 67.4 bits (163), Expect = 4e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPF ST+A TGAP+G+ +GDR+F DSSSRN DIMDLR GGLR Sbjct: 576 DPFVSTSAMTGAPLGTSSGDRAFPDSSSRNADIMDLRGGGLR 617 >XP_010664674.2 PREDICTED: uncharacterized membrane protein At1g75140 [Vitis vinifera] Length = 730 Score = 67.4 bits (163), Expect = 4e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPF ST+A TGAP+G+ +GDR+F DSSSRN DIMDLR GGLR Sbjct: 615 DPFVSTSAMTGAPLGTSSGDRAFPDSSSRNADIMDLRGGGLR 656 >KYP72295.1 putative membrane protein At1g75140 family [Cajanus cajan] Length = 442 Score = 67.0 bits (162), Expect = 5e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+ SG+GDRSF DSSSR+ ++MDLR G LR Sbjct: 326 DPFSSTSATTGAPMASGSGDRSFADSSSRSSEVMDLRGGNLR 367 >KHN20991.1 Putative membrane protein [Glycine soja] Length = 650 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A T AP+ SG+GDRSF DSSSR+ ++MDLR G LR Sbjct: 533 DPFSSTSATTSAPLASGSGDRSFADSSSRSSEVMDLRGGNLR 574 >XP_006595940.1 PREDICTED: uncharacterized membrane protein At1g75140-like [Glycine max] KRH15232.1 hypothetical protein GLYMA_14G076200 [Glycine max] Length = 650 Score = 65.1 bits (157), Expect = 3e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A T AP+ SG+GDRSF DSSSR+ ++MDLR G LR Sbjct: 533 DPFSSTSATTSAPLASGSGDRSFADSSSRSSEVMDLRGGNLR 574 >XP_006386930.1 hypothetical protein POPTR_0002s26370g [Populus trichocarpa] ERP64727.1 hypothetical protein POPTR_0002s26370g [Populus trichocarpa] Length = 623 Score = 64.3 bits (155), Expect = 5e-09 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAG-DRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+GS A DRSFVDSSSR+ D+MDLR+ GLR Sbjct: 512 DPFSSTSATTGAPLGSSASADRSFVDSSSRSSDMMDLRASGLR 554 >XP_011006751.1 PREDICTED: uncharacterized membrane protein At1g75140-like [Populus euphratica] Length = 723 Score = 64.3 bits (155), Expect = 5e-09 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAG-DRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A TGAP+GS A DRSFVDSSSR+ D+MDLR+ GLR Sbjct: 607 DPFSSTSATTGAPLGSSASADRSFVDSSSRSSDMMDLRASGLR 649 >XP_002510361.1 PREDICTED: uncharacterized membrane protein At1g75140 [Ricinus communis] EEF52548.1 conserved hypothetical protein [Ricinus communis] Length = 651 Score = 63.9 bits (154), Expect = 7e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSS A TGA +GS +GDR+F DSSSR DIM+LRSGGLR Sbjct: 536 DPFSSPAATTGASLGSSSGDRAFADSSSRRDDIMELRSGGLR 577 >KDP38483.1 hypothetical protein JCGZ_04408 [Jatropha curcas] Length = 444 Score = 63.5 bits (153), Expect = 9e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A T AP+GS +GDRSFV+SSSR D+M+LR+ GLR Sbjct: 327 DPFSSTSATTAAPLGSSSGDRSFVNSSSRRDDMMELRTSGLR 368 >XP_004291886.1 PREDICTED: uncharacterized membrane protein At1g75140 [Fragaria vesca subsp. vesca] Length = 620 Score = 63.5 bits (153), Expect = 9e-09 Identities = 30/43 (69%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -3 Query: 494 DPFSSTTAATGAPIG-SGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A GAP+G + +G+RSFVDSSSRN D+MD+R GGLR Sbjct: 504 DPFSSTSATAGAPLGGNSSGERSFVDSSSRNADMMDIRGGGLR 546 >XP_012071813.1 PREDICTED: uncharacterized membrane protein At1g75140 [Jatropha curcas] Length = 654 Score = 63.5 bits (153), Expect = 9e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A T AP+GS +GDRSFV+SSSR D+M+LR+ GLR Sbjct: 537 DPFSSTSATTAAPLGSSSGDRSFVNSSSRRDDMMELRTSGLR 578 >XP_016687548.1 PREDICTED: uncharacterized membrane protein At1g75140-like [Gossypium hirsutum] Length = 694 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 494 DPFSSTTAATGAPIGSGAGDRSFVDSSSRNKDIMDLRSGGLR 369 DPFSST+A AP+GS GDRSF+DSSSR D+ DLRS GLR Sbjct: 514 DPFSSTSATNSAPLGSNTGDRSFIDSSSRGADMADLRSSGLR 555