BLASTX nr result
ID: Phellodendron21_contig00024152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024152 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417838.1 hypothetical protein MELLADRAFT_95061 [Melampsora... 68 6e-18 >XP_007417838.1 hypothetical protein MELLADRAFT_95061 [Melampsora larici-populina 98AG31] EGF98907.1 hypothetical protein MELLADRAFT_95061 [Melampsora larici-populina 98AG31] Length = 943 Score = 68.2 bits (165), Expect(2) = 6e-18 Identities = 37/66 (56%), Positives = 47/66 (71%) Frame = +1 Query: 139 VKAELEFIKESIKKLPEPLRLELTFGKMSGKFGDRQLCDIYKRLVQCTSSLAVVQDQIQE 318 +KA+L+ I +++KKLPE L+LE T G GK GD+Q+ DI RLVQ T+ L VQ QIQE Sbjct: 872 MKADLQSINQAVKKLPEHLQLEWTRGTTQGKLGDKQIQDIQHRLVQGTTCLEWVQIQIQE 931 Query: 319 LNINLA 336 LN LA Sbjct: 932 LNDTLA 937 Score = 49.7 bits (117), Expect(2) = 6e-18 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +3 Query: 6 DQANPSLSEGERRWFSELGRMKAEVSGEPGACTSGGLVFNMTKL 137 D+ NP+LSEGERRWFSEL RMK EV E + GL + K+ Sbjct: 829 DRVNPTLSEGERRWFSELRRMKTEVGCEEKTGSRSGLFAEVEKM 872