BLASTX nr result
ID: Phellodendron21_contig00024061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00024061 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403889.1 hypothetical protein MELLADRAFT_101445 [Melampsor... 87 2e-19 >XP_007403889.1 hypothetical protein MELLADRAFT_101445 [Melampsora larici-populina 98AG31] EGG12951.1 hypothetical protein MELLADRAFT_101445 [Melampsora larici-populina 98AG31] Length = 144 Score = 86.7 bits (213), Expect = 2e-19 Identities = 47/94 (50%), Positives = 55/94 (58%) Frame = -1 Query: 337 GYFRLNGLLTFGIGGSLGLANAALRPFPALQQSAEQVRLNDFSXXXXXXXXXXXXXIFAH 158 GYFRLNG+LTFGIGGSLG+ANA LRP P ++Q+ E+VRLNDFS FAH Sbjct: 50 GYFRLNGVLTFGIGGSLGIANATLRPIPRVEQTHERVRLNDFSIIGGSLGSLIISTFFAH 109 Query: 157 RGFWQVLXXXXXXXXXXXXXGFLTGIFQRRPKDS 56 RG +VL GFLTGI + S Sbjct: 110 RGILKVLSLIPGGASFGIATGFLTGIINTKSDKS 143