BLASTX nr result
ID: Phellodendron21_contig00023971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023971 (685 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006434060.1 hypothetical protein CICLE_v10002988mg [Citrus cl... 78 3e-15 OMO85759.1 hypothetical protein CCACVL1_10014 [Corchorus capsula... 52 8e-06 >XP_006434060.1 hypothetical protein CICLE_v10002988mg [Citrus clementina] ESR47300.1 hypothetical protein CICLE_v10002988mg [Citrus clementina] KDO80864.1 hypothetical protein CISIN_1g034756mg [Citrus sinensis] Length = 85 Score = 77.8 bits (190), Expect = 3e-15 Identities = 39/57 (68%), Positives = 44/57 (77%) Frame = -1 Query: 454 MAMAGVAGFSLTEAYALRAMHKQKMKNLEKQEASNQSTGVVSVAVDEKKIPSGCFIW 284 MAMAGVAG SL E YA+RAMHK+KMK LEKQ+AS + S A DEK+IPSGCF W Sbjct: 1 MAMAGVAGLSLVEVYAMRAMHKEKMKKLEKQKASK----IGSTADDEKEIPSGCFFW 53 >OMO85759.1 hypothetical protein CCACVL1_10014 [Corchorus capsularis] Length = 74 Score = 52.4 bits (124), Expect = 8e-06 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = -1 Query: 454 MAMAGVAGFSLTEAYALRAMHKQKMKNLEKQEASNQSTGVVSVAVDEKKIPSGCFIW 284 MA AG G L E Y +R++HKQK K LE+ ++ ++ V V DE K PSGCF W Sbjct: 1 MASAGYGGVGLAEVYVMRSLHKQKTKKLERAKSDDK----VVVGGDE-KFPSGCFFW 52