BLASTX nr result
ID: Phellodendron21_contig00023960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023960 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006477323.1 PREDICTED: probable aminotransferase ACS10 [Citru... 55 1e-06 XP_006440457.1 hypothetical protein CICLE_v10019580mg [Citrus cl... 55 1e-06 >XP_006477323.1 PREDICTED: probable aminotransferase ACS10 [Citrus sinensis] Length = 547 Score = 55.1 bits (131), Expect = 1e-06 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 107 MTRTRPDEESKP-TSNSRSGGGTAMRVIVPLQGVVQ 3 MTR R DEE KP +S+S SGGGTAMRVIVPLQGVVQ Sbjct: 1 MTRARADEEPKPISSSSSSGGGTAMRVIVPLQGVVQ 36 >XP_006440457.1 hypothetical protein CICLE_v10019580mg [Citrus clementina] ESR53697.1 hypothetical protein CICLE_v10019580mg [Citrus clementina] Length = 547 Score = 55.1 bits (131), Expect = 1e-06 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -2 Query: 107 MTRTRPDEESKP-TSNSRSGGGTAMRVIVPLQGVVQ 3 MTR R DEE KP +S+S SGGGTAMRVIVPLQGVVQ Sbjct: 1 MTRARADEEPKPISSSSSSGGGTAMRVIVPLQGVVQ 36