BLASTX nr result
ID: Phellodendron21_contig00023921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023921 (1233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009318202.1 ribosomal protein L32 (chloroplast) [Corylus avel... 69 1e-11 YP_009166173.1 ribosomal protein L32 (chloroplast) [Zanthoxylum ... 54 5e-06 >YP_009318202.1 ribosomal protein L32 (chloroplast) [Corylus avellana] YP_009318282.1 ribosomal protein L32 (chloroplast) [Corylus heterophylla] YP_009318125.1 ribosomal protein L32 (chloroplast) [Corylus fargesii] YP_009331522.1 ribosomal protein L32 (chloroplast) [Corylus chinensis] AOZ20326.1 ribosomal protein L32 (chloroplast) [Corylus fargesii] AOZ20404.1 ribosomal protein L32 (chloroplast) [Corylus avellana] AOZ20484.1 ribosomal protein L32 (chloroplast) [Corylus heterophylla] APF31771.1 ribosomal protein L32 (chloroplast) [Corylus chinensis] Length = 56 Score = 69.3 bits (168), Expect = 1e-11 Identities = 35/55 (63%), Positives = 39/55 (70%) Frame = -2 Query: 944 LFICCTKKLFEFPVERDFANEKAFNAAQYPXXXXXXXXXXXFNIEVRFFGTAIQK 780 ++ KKLFEFPVERDFANEKAFNA QYP F+IEVRFFGTAI+K Sbjct: 1 MYFLLYKKLFEFPVERDFANEKAFNATQYPSIFQIFLRIRFFDIEVRFFGTAIKK 55 >YP_009166173.1 ribosomal protein L32 (chloroplast) [Zanthoxylum piperitum] YP_009307174.1 ribosomal protein L32 (chloroplast) [Zanthoxylum bungeanum] AKZ89370.1 ribosomal protein L32 (chloroplast) [Zanthoxylum piperitum] AOR53619.1 ribosomal protein L32 (chloroplast) [Zanthoxylum bungeanum] Length = 57 Score = 53.5 bits (127), Expect = 5e-06 Identities = 29/57 (50%), Positives = 30/57 (52%) Frame = +1 Query: 787 MAVPKKRTSXXXXXXXXXXXXXXGYWXXXXXXXXXXXXXTGNSKSFFVQQINKKTLE 957 MAVPKKRTS GYW TGNSKSFFVQQINKKTL+ Sbjct: 1 MAVPKKRTSILKKRIRKNIWKKGGYWAALKAFSLAKSLSTGNSKSFFVQQINKKTLK 57