BLASTX nr result
ID: Phellodendron21_contig00023912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023912 (681 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016763503.1 PR-1-like protein [Sphaerulina musiva SO2202] EMF... 102 7e-23 EME47364.1 hypothetical protein DOTSEDRAFT_69335 [Dothistroma se... 85 5e-16 D4B327.2 RecName: Full=Probable pathogenesis-related protein ARB... 80 2e-14 XP_003010963.1 SCP-like extracellular protein, putative [Trichop... 80 5e-14 KXS98711.1 hypothetical protein AC578_10490 [Mycosphaerella eumu... 77 3e-13 ODM16792.1 hypothetical protein SI65_07757 [Aspergillus cristatus] 77 6e-13 XP_003231592.1 hypothetical protein TERG_07892 [Trichophyton rub... 76 7e-13 OAL73435.1 hypothetical protein A7D00_1461 [Trichophyton violaceum] 76 8e-13 EZG10505.1 hypothetical protein H106_00572 [Trichophyton rubrum ... 76 8e-13 EZF78151.1 hypothetical protein H105_00772 [Trichophyton soudane... 76 8e-13 XP_016208738.1 hypothetical protein PV09_09394 [Verruconis gallo... 75 1e-12 XP_003020362.1 SCP-like extracellular protein, putative [Trichop... 75 2e-12 KDB27711.1 hypothetical protein H109_00505 [Trichophyton interdi... 75 2e-12 EZF28557.1 hypothetical protein H101_07763 [Trichophyton interdi... 75 2e-12 XP_002848662.1 extensin [Arthroderma otae CBS 113480] EEQ28777.1... 75 2e-12 EGD98303.1 hypothetical protein TESG_05682 [Trichophyton tonsura... 75 3e-12 EYE92458.1 PR-1-like protein [Aspergillus ruber CBS 135680] 74 4e-12 KEQ85800.1 PR-1-like protein [Aureobasidium pullulans EXF-150] 74 4e-12 XP_007676589.1 hypothetical protein BAUCODRAFT_148171 [Baudoinia... 75 4e-12 OJJ80991.1 hypothetical protein ASPGLDRAFT_133614 [Aspergillus g... 74 6e-12 >XP_016763503.1 PR-1-like protein [Sphaerulina musiva SO2202] EMF15382.1 PR-1-like protein [Sphaerulina musiva SO2202] Length = 258 Score = 102 bits (254), Expect = 7e-23 Identities = 63/158 (39%), Positives = 73/158 (46%), Gaps = 2/158 (1%) Frame = +3 Query: 213 PFNGKRAEAPSYGNXXXXXXXXXXXXXXXXXAGGDAPEATPEAPKHYGHKHTKVTTTTEA 392 PF+ +RAEA SYG A +AP TPE KHYGH Sbjct: 18 PFHERRAEAGSYG---PDVDVVYVTAVVTVTADEEAPAYTPEV-KHYGHNFPS------Q 67 Query: 393 PAPVXXXXXXXXXXXXXXXXXXXXXXXXVEXXXXXXXXXXXXXXX--YQDTCLYHHNIHR 566 P P VE Y+DTCLYHHN+HR Sbjct: 68 PQPPAYTPEPEPTPPEAAPEAPPSYEPPVESTPAPPPAAPGPPKSGGYEDTCLYHHNLHR 127 Query: 567 ANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 ANH+APDLTWS L++TA+KIAE C Y H+VEMDGGGY Sbjct: 128 ANHSAPDLTWSDDLKNTAKKIAETCKYEHNVEMDGGGY 165 >EME47364.1 hypothetical protein DOTSEDRAFT_69335 [Dothistroma septosporum NZE10] Length = 280 Score = 84.7 bits (208), Expect = 5e-16 Identities = 48/129 (37%), Positives = 57/129 (44%), Gaps = 9/129 (6%) Frame = +3 Query: 321 PEATPEAPKHYGHKH---------TKVTTTTEAPAPVXXXXXXXXXXXXXXXXXXXXXXX 473 P ATPEAPKHYGH + T VTT++ APA Sbjct: 47 PAATPEAPKHYGHHNNYNNPVAYTTVVTTSSAAPAAYSPPAVEQPATTSSAPAYSASSAS 106 Query: 474 XVEXXXXXXXXXXXXXXXYQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAH 653 E Y C+YHHN+HRANH+ D+ W L AQ IAE C YAH Sbjct: 107 GPEPTD------------YAGKCVYHHNLHRANHSVSDIAWDDGLASIAQTIAESCVYAH 154 Query: 654 DVEMDGGGY 680 +V+ GGGY Sbjct: 155 NVQEGGGGY 163 >D4B327.2 RecName: Full=Probable pathogenesis-related protein ARB_02861; AltName: Full=Wasp ves v 5 allergen homolog; Flags: Precursor DAA73540.1 TPA_exp: putative pathogenesis-related protein [Trichophyton benhamiae CBS 112371] Length = 309 Score = 80.5 bits (197), Expect = 2e-14 Identities = 30/51 (58%), Positives = 41/51 (80%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y++ YHHN+HR+NH+AP LTWS +L+ +A+K+AE CNY HD +DGGGY Sbjct: 150 YKEVAGYHHNVHRSNHSAPALTWSSALESSARKLAESCNYGHDTSIDGGGY 200 >XP_003010963.1 SCP-like extracellular protein, putative [Trichophyton benhamiae CBS 112371] EFE30323.1 SCP-like extracellular protein, putative [Trichophyton benhamiae CBS 112371] Length = 414 Score = 80.5 bits (197), Expect = 5e-14 Identities = 30/51 (58%), Positives = 41/51 (80%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y++ YHHN+HR+NH+AP LTWS +L+ +A+K+AE CNY HD +DGGGY Sbjct: 150 YKEVAGYHHNVHRSNHSAPALTWSSALESSARKLAESCNYGHDTSIDGGGY 200 >KXS98711.1 hypothetical protein AC578_10490 [Mycosphaerella eumusae] Length = 307 Score = 77.4 bits (189), Expect = 3e-13 Identities = 40/117 (34%), Positives = 50/117 (42%), Gaps = 3/117 (2%) Frame = +3 Query: 339 APKHYGHK---HTKVTTTTEAPAPVXXXXXXXXXXXXXXXXXXXXXXXXVEXXXXXXXXX 509 AP+HYGH H V TT A P Sbjct: 74 APQHYGHHNNWHPSVAYTTPAQQPETTPTPQSSTSTTQTYEAPTTSVAPTAAPTPTKPAT 133 Query: 510 XXXXXXYQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y D +YHHN+HRANH+ PD+ WS L +A +IA+ C YAH+ E+ GGGY Sbjct: 134 GSAPSGYNDLVVYHHNLHRANHSCPDIEWSDDLYSSALEIAQSCVYAHNTEVQGGGY 190 >ODM16792.1 hypothetical protein SI65_07757 [Aspergillus cristatus] Length = 317 Score = 76.6 bits (187), Expect = 6e-13 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 YQ LYHHNIHR+NH+A LTWS +LQ +AQK+A C Y HD +DGGGY Sbjct: 156 YQQAILYHHNIHRSNHSANSLTWSDNLQASAQKLAARCVYEHDTSIDGGGY 206 >XP_003231592.1 hypothetical protein TERG_07892 [Trichophyton rubrum CBS 118892] EGD91673.1 hypothetical protein TERG_07892 [Trichophyton rubrum CBS 118892] EZF27185.1 hypothetical protein H100_00778 [Trichophyton rubrum MR850] EZF46285.1 hypothetical protein H102_00768 [Trichophyton rubrum CBS 100081] EZF56944.1 hypothetical protein H103_00775 [Trichophyton rubrum CBS 288.86] EZF67488.1 hypothetical protein H104_00762 [Trichophyton rubrum CBS 289.86] EZF88808.1 hypothetical protein H110_00778 [Trichophyton rubrum MR1448] EZF99679.1 hypothetical protein H113_00778 [Trichophyton rubrum MR1459] EZG21154.1 hypothetical protein H107_00829 [Trichophyton rubrum CBS 202.88] KDB38027.1 hypothetical protein H112_00779 [Trichophyton rubrum D6] KMQ43423.1 putative cysteine-rich secretory protein, allergen V5/Tpx-1 [Trichophyton rubrum] OAL67153.1 hypothetical protein A7C99_1568 [Trichophyton rubrum] Length = 294 Score = 76.3 bits (186), Expect = 7e-13 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y+ +HHNIHR+NH+AP LTWS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 135 YKGLACHHHNIHRSNHSAPALTWSSALESSARKLAESCRYGHDTSIDGGGY 185 >OAL73435.1 hypothetical protein A7D00_1461 [Trichophyton violaceum] Length = 306 Score = 76.3 bits (186), Expect = 8e-13 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y+ +HHNIHR+NH+AP LTWS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 147 YKGLACHHHNIHRSNHSAPALTWSSALESSARKLAESCRYGHDTSIDGGGY 197 >EZG10505.1 hypothetical protein H106_00572 [Trichophyton rubrum CBS 735.88] Length = 306 Score = 76.3 bits (186), Expect = 8e-13 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y+ +HHNIHR+NH+AP LTWS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 147 YKGLACHHHNIHRSNHSAPALTWSSALESSARKLAESCRYGHDTSIDGGGY 197 >EZF78151.1 hypothetical protein H105_00772 [Trichophyton soudanense CBS 452.61] Length = 306 Score = 76.3 bits (186), Expect = 8e-13 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y+ +HHNIHR+NH+AP LTWS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 147 YKGLACHHHNIHRSNHSAPALTWSSALESSARKLAESCRYGHDTSIDGGGY 197 >XP_016208738.1 hypothetical protein PV09_09394 [Verruconis gallopava] KIV98868.1 hypothetical protein PV09_09394 [Verruconis gallopava] Length = 252 Score = 74.7 bits (182), Expect = 1e-12 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y T + HHN HR NH+AP++ W L TAQKIAE C YAHD +DGGGY Sbjct: 81 YSATVVAHHNAHRTNHSAPEIAWDDGLAATAQKIAESCTYAHDTSIDGGGY 131 >XP_003020362.1 SCP-like extracellular protein, putative [Trichophyton verrucosum HKI 0517] EFE39744.1 SCP-like extracellular protein, putative [Trichophyton verrucosum HKI 0517] Length = 330 Score = 75.5 bits (184), Expect = 2e-12 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y++ YHHN+HR+NH+AP LTWS +L+++A+K+AE C Y HD +DGGGY Sbjct: 149 YKEQTDYHHNVHRSNHSAPALTWSTALENSARKLAETCIYGHDTSIDGGGY 199 >KDB27711.1 hypothetical protein H109_00505 [Trichophyton interdigitale MR816] Length = 303 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y++ YHHN+HR+NH+AP L+WS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 144 YKEQTNYHHNVHRSNHSAPALSWSSALESSAKKLAESCVYGHDTSIDGGGY 194 >EZF28557.1 hypothetical protein H101_07763 [Trichophyton interdigitale H6] Length = 303 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y++ YHHN+HR+NH+AP L+WS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 144 YKEQTNYHHNVHRSNHSAPALSWSSALESSAKKLAESCVYGHDTSIDGGGY 194 >XP_002848662.1 extensin [Arthroderma otae CBS 113480] EEQ28777.1 extensin [Arthroderma otae CBS 113480] Length = 289 Score = 74.7 bits (182), Expect = 2e-12 Identities = 27/51 (52%), Positives = 41/51 (80%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y+ T +YHHN+HR+NH+A DLTW +L++ A+++AE C+Y H+ E+ GGGY Sbjct: 130 YKGTVMYHHNVHRSNHSASDLTWDSTLENYARQLAESCSYGHNTEIGGGGY 180 >EGD98303.1 hypothetical protein TESG_05682 [Trichophyton tonsurans CBS 112818] Length = 303 Score = 74.7 bits (182), Expect = 3e-12 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 Y++ YHHN+HR+NH+AP L+WS +L+ +A+K+AE C Y HD +DGGGY Sbjct: 144 YKEQTDYHHNVHRSNHSAPALSWSSALESSAKKLAESCVYGHDTSIDGGGY 194 >EYE92458.1 PR-1-like protein [Aspergillus ruber CBS 135680] Length = 322 Score = 74.3 bits (181), Expect = 4e-12 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 YQ LY+HNIHR+NH+A LTWS +LQ +AQK+A C Y HD +DGGGY Sbjct: 161 YQQAILYNHNIHRSNHSASSLTWSDTLQASAQKLAARCVYEHDTSIDGGGY 211 >KEQ85800.1 PR-1-like protein [Aureobasidium pullulans EXF-150] Length = 291 Score = 73.9 bits (180), Expect = 4e-12 Identities = 43/124 (34%), Positives = 55/124 (44%), Gaps = 3/124 (2%) Frame = +3 Query: 318 APEATPEA---PKHYGHKHTKVTTTTEAPAPVXXXXXXXXXXXXXXXXXXXXXXXXVEXX 488 AP AT EA +HYGH+H+ + APV Sbjct: 66 APAATTEAVLTSQHYGHRHSWSKAAQSSAAPVVTVVTSEAPAATVASTTAAAPAGKATT- 124 Query: 489 XXXXXXXXXXXXXYQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMD 668 YQ + HHN+HRANH+AP LTW L +TA KIA C YAH ++++ Sbjct: 125 -------------YQQRVVDHHNVHRANHSAPALTWDTDLANTAAKIAATCVYAHSMDVN 171 Query: 669 GGGY 680 GGGY Sbjct: 172 GGGY 175 >XP_007676589.1 hypothetical protein BAUCODRAFT_148171 [Baudoinia panamericana UAMH 10762] EMC96586.1 hypothetical protein BAUCODRAFT_148171 [Baudoinia panamericana UAMH 10762] Length = 388 Score = 74.7 bits (182), Expect = 4e-12 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 YQD +YHHNIHR NH+AP++ W L +TA IA CNY+H+ +++GGGY Sbjct: 215 YQDVAVYHHNIHRVNHSAPNIVWDTGLANTAAIIASSCNYSHNTDVNGGGY 265 >OJJ80991.1 hypothetical protein ASPGLDRAFT_133614 [Aspergillus glaucus CBS 516.65] Length = 319 Score = 73.9 bits (180), Expect = 6e-12 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 528 YQDTCLYHHNIHRANHTAPDLTWSQSLQDTAQKIAEGCNYAHDVEMDGGGY 680 YQ LY+HNIHR+NH+A LTWS +LQ +AQK+A C Y HD +DGGGY Sbjct: 158 YQHAILYNHNIHRSNHSASSLTWSDTLQASAQKLAARCVYEHDTSIDGGGY 208