BLASTX nr result
ID: Phellodendron21_contig00023873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023873 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007920816.1 hypothetical protein MYCFIDRAFT_180921 [Pseudocer... 79 4e-17 KIJ34665.1 hypothetical protein M422DRAFT_181886 [Sphaerobolus s... 77 3e-16 EME50198.1 hypothetical protein DOTSEDRAFT_41329 [Dothistroma se... 77 3e-16 XP_001239989.1 plasma membrane proteolipid 3 [Coccidioides immit... 77 3e-16 KLJ11945.1 plasma membrane proteolipid 3, partial [Emmonsia parv... 76 4e-16 GAW17114.1 hypothetical protein ANO14919_065640 [fungal sp. No.1... 76 5e-16 KKZ62758.1 plasma membrane proteolipid 3 [Emmonsia crescens UAMH... 76 5e-16 XP_009542596.1 putative stress-induced hydrophobic peptide [Hete... 76 5e-16 XP_013021888.1 plasma membrane proteolipid Pmp3 [Schizosaccharom... 76 5e-16 XP_013017507.1 plasma membrane proteolipid Pmp3 [Schizosaccharom... 76 5e-16 XP_007674090.1 hypothetical protein BAUCODRAFT_389265 [Baudoinia... 76 5e-16 XP_002621662.1 stress response RCI peptide [Blastomyces gilchris... 76 5e-16 GAM82162.1 hypothetical protein ANO11243_001410 [fungal sp. No.1... 76 7e-16 KEQ87443.1 UPF0057-domain-containing protein [Aureobasidium pull... 76 7e-16 XP_013423219.1 UPF0057-domain-containing protein [Aureobasidium ... 76 7e-16 KEQ59816.1 UPF0057-domain-containing protein [Aureobasidium mela... 76 7e-16 NP_595350.2 plasma membrane proteolipid Pmp3 [Schizosaccharomyce... 76 7e-16 XP_003856424.1 hypothetical protein MYCGRDRAFT_78728 [Zymoseptor... 76 7e-16 XP_019004830.1 plasma membrane proteolipid 3 [Kwoniella mangrovi... 75 9e-16 XP_018264696.1 plasma membrane proteolipid 3 [Kwoniella dejectic... 75 9e-16 >XP_007920816.1 hypothetical protein MYCFIDRAFT_180921 [Pseudocercospora fijiensis CIRAD86] EME87335.1 hypothetical protein MYCFIDRAFT_180921 [Pseudocercospora fijiensis CIRAD86] KXS97565.1 hypothetical protein AC578_9787 [Mycosphaerella eumusae] OCK82574.1 UPF0057-domain-containing protein [Lepidopterella palustris CBS 459.81] Length = 57 Score = 79.0 bits (193), Expect = 4e-17 Identities = 40/49 (81%), Positives = 40/49 (81%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKIIFAILLPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIIFAILLPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >KIJ34665.1 hypothetical protein M422DRAFT_181886 [Sphaerobolus stellatus SS14] Length = 57 Score = 76.6 bits (187), Expect = 3e-16 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAI+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 10 KIIFAIILPPLGVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >EME50198.1 hypothetical protein DOTSEDRAFT_41329 [Dothistroma septosporum NZE10] Length = 57 Score = 76.6 bits (187), Expect = 3e-16 Identities = 39/49 (79%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKII AILLPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIILAILLPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >XP_001239989.1 plasma membrane proteolipid 3 [Coccidioides immitis RS] XP_003069213.1 hypothetical protein CPC735_024040 [Coccidioides posadasii C735 delta SOWgp] EER27068.1 hypothetical protein CPC735_024040 [Coccidioides posadasii C735 delta SOWgp] EFW21034.1 hypothetical protein CPSG_02877 [Coccidioides posadasii str. Silveira] EAS28406.3 plasma membrane proteolipid 3 [Coccidioides immitis RS] KMM66752.1 plasma membrane proteolipid 3 [Coccidioides posadasii RMSCC 3488] KMP02794.1 plasma membrane proteolipid 3 [Coccidioides immitis RMSCC 2394] KMU92111.1 hypothetical protein CIHG_09865 [Coccidioides immitis H538.4] Length = 57 Score = 76.6 bits (187), Expect = 3e-16 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAI+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 10 KIIFAIILPPLGVFLERGCGADLLINICLTILGYIPGIIHALYIILKY 57 >KLJ11945.1 plasma membrane proteolipid 3, partial [Emmonsia parva UAMH 139] Length = 51 Score = 76.3 bits (186), Expect = 4e-16 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAILLPP+GVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 4 KIIFAILLPPVGVFLERGCGADLLINICLTILGYIPGIIHALYIILKY 51 >GAW17114.1 hypothetical protein ANO14919_065640 [fungal sp. No.14919] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFA++LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 10 KIIFAVILPPLGVFLERGCGADFLINILLTVLGYIPGIIHALYIILKY 57 >KKZ62758.1 plasma membrane proteolipid 3 [Emmonsia crescens UAMH 3008] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAILLPP+GVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 10 KIIFAILLPPVGVFLERGCGADLLINICLTILGYIPGIIHALYIILKY 57 >XP_009542596.1 putative stress-induced hydrophobic peptide [Heterobasidion irregulare TC 32-1] ETW85769.1 putative stress-induced hydrophobic peptide [Heterobasidion irregulare TC 32-1] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFA+LLPP+GVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 10 KIIFAVLLPPIGVFLERGCGADLVINILLTILGYIPGIIHALYIILKY 57 >XP_013021888.1 plasma membrane proteolipid Pmp3 [Schizosaccharomyces cryophilus OY26] EPY54281.1 plasma membrane proteolipid Pmp3 [Schizosaccharomyces cryophilus OY26] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAI+LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 10 KIIFAIILPPLGVFLERGCGADILINILLCCLGYVPGIIHALYIILKY 57 >XP_013017507.1 plasma membrane proteolipid Pmp3 [Schizosaccharomyces octosporus yFS286] EPX74356.1 plasma membrane proteolipid Pmp3 [Schizosaccharomyces octosporus yFS286] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAI+LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 10 KIIFAIILPPLGVFLERGCGADIIINILLCCLGYVPGIIHALYIILKY 57 >XP_007674090.1 hypothetical protein BAUCODRAFT_389265 [Baudoinia panamericana UAMH 10762] EMC99051.1 hypothetical protein BAUCODRAFT_389265 [Baudoinia panamericana UAMH 10762] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 39/49 (79%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKII AILLPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIIVAILLPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >XP_002621662.1 stress response RCI peptide [Blastomyces gilchristii SLH14081] EEQ91762.1 plasma membrane proteolipid 3 [Blastomyces dermatitidis ER-3] EGE81063.1 plasma membrane proteolipid 3 [Blastomyces dermatitidis ATCC 18188] EQL30241.1 plasma membrane proteolipid 3 [Blastomyces dermatitidis ATCC 26199] OAT12551.1 plasma membrane proteolipid 3 [Blastomyces gilchristii SLH14081] Length = 57 Score = 76.3 bits (186), Expect = 5e-16 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 KIIFAILLPP+GVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 10 KIIFAILLPPVGVFLERGCGADLLINICLTVLGYIPGIIHALYIILKY 57 >GAM82162.1 hypothetical protein ANO11243_001410 [fungal sp. No.11243] Length = 57 Score = 75.9 bits (185), Expect = 7e-16 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKIIFAI+LPPLGVFLERGCGAD L YIPGIIHALYIILKY Sbjct: 9 IKIIFAIILPPLGVFLERGCGADLLINILLTLLAYIPGIIHALYIILKY 57 >KEQ87443.1 UPF0057-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 57 Score = 75.9 bits (185), Expect = 7e-16 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKII AI+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIIIAIILPPLGVFLERGCGADLLINLLLTILGYIPGIIHALYIILKY 57 >XP_013423219.1 UPF0057-domain-containing protein [Aureobasidium namibiae CBS 147.97] KEQ69022.1 UPF0057-domain-containing protein [Aureobasidium namibiae CBS 147.97] Length = 57 Score = 75.9 bits (185), Expect = 7e-16 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKII AI+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIIIAIILPPLGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >KEQ59816.1 UPF0057-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 57 Score = 75.9 bits (185), Expect = 7e-16 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKII AI+LPPLGVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIILAIILPPLGVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >NP_595350.2 plasma membrane proteolipid Pmp3 [Schizosaccharomyces pombe 972h-] Q9C1W4.2 RecName: Full=Plasma membrane proteolipid 3 CAC22612.2 plasma membrane proteolipid Pmp3 [Schizosaccharomyces pombe] Length = 57 Score = 75.9 bits (185), Expect = 7e-16 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = -2 Query: 393 KIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 K+IFAI+LPPLGVFLERGCGAD LGY+PGIIHALYIILKY Sbjct: 10 KVIFAIILPPLGVFLERGCGADVIINILLCCLGYVPGIIHALYIILKY 57 >XP_003856424.1 hypothetical protein MYCGRDRAFT_78728 [Zymoseptoria tritici IPO323] EGP91400.1 hypothetical protein MYCGRDRAFT_78728 [Zymoseptoria tritici IPO323] KJX97074.1 plasma membrane proteolipid 3 like protein [Zymoseptoria brevis] Length = 57 Score = 75.9 bits (185), Expect = 7e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKIIFAI +PP+GVFLERGCGAD LGYIPGIIHALYIILKY Sbjct: 9 IKIIFAIFIPPIGVFLERGCGADLLINILLTILGYIPGIIHALYIILKY 57 >XP_019004830.1 plasma membrane proteolipid 3 [Kwoniella mangroviensis CBS 8507] XP_019050358.1 plasma membrane proteolipid 3 [Kwoniella bestiolae CBS 10118] OCF29288.1 plasma membrane proteolipid 3 [Kwoniella bestiolae CBS 10118] OCF57931.1 plasma membrane proteolipid 3 [Kwoniella mangroviensis CBS 10435] OCF68291.1 plasma membrane proteolipid 3 [Kwoniella mangroviensis CBS 8507] OCF74967.1 plasma membrane proteolipid 3 [Kwoniella mangroviensis CBS 8886] Length = 57 Score = 75.5 bits (184), Expect = 9e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKIIFA++LPPLGVFLERGC AD LGYIPGIIHALYIILKY Sbjct: 9 IKIIFAVILPPLGVFLERGCNADFLINILLTILGYIPGIIHALYIILKY 57 >XP_018264696.1 plasma membrane proteolipid 3 [Kwoniella dejecticola CBS 10117] OBR86854.1 plasma membrane proteolipid 3 [Kwoniella dejecticola CBS 10117] Length = 57 Score = 75.5 bits (184), Expect = 9e-16 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = -2 Query: 396 IKIIFAILLPPLGVFLERGCGADXXXXXXXXXLGYIPGIIHALYIILKY 250 IKIIFA++LPPLGVFLERGC AD LGYIPGIIHALYIILKY Sbjct: 9 IKIIFAVILPPLGVFLERGCNADFLINILLTVLGYIPGIIHALYIILKY 57