BLASTX nr result
ID: Phellodendron21_contig00023794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023794 (434 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006449053.1 hypothetical protein CICLE_v10015461mg [Citrus cl... 73 2e-12 KDO75487.1 hypothetical protein CISIN_1g041936mg, partial [Citru... 71 9e-12 XP_006449054.1 hypothetical protein CICLE_v10015479mg [Citrus cl... 71 9e-12 XP_006468012.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-11 CBI32989.3 unnamed protein product, partial [Vitis vinifera] 64 5e-09 XP_003634851.2 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-09 CAN77919.1 hypothetical protein VITISV_027645 [Vitis vinifera] 63 6e-09 XP_010101448.1 hypothetical protein L484_012870 [Morus notabilis... 63 9e-09 XP_011652746.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-08 KJB22838.1 hypothetical protein B456_004G069000 [Gossypium raimo... 57 2e-08 XP_008224804.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 4e-08 XP_002305587.1 pentatricopeptide repeat-containing family protei... 60 5e-08 KDO75485.1 hypothetical protein CISIN_1g015765mg [Citrus sinensi... 60 6e-08 XP_006468013.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 6e-08 XP_011037679.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 6e-08 XP_010476095.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 6e-08 XP_006307697.1 hypothetical protein CARUB_v10009327mg [Capsella ... 59 1e-07 XP_002892652.1 pentatricopeptide repeat-containing protein [Arab... 59 1e-07 JAU95992.1 Pentatricopeptide repeat-containing protein, mitochon... 59 1e-07 JAU56535.1 Pentatricopeptide repeat-containing protein, mitochon... 59 1e-07 >XP_006449053.1 hypothetical protein CICLE_v10015461mg [Citrus clementina] ESR62293.1 hypothetical protein CICLE_v10015461mg [Citrus clementina] Length = 404 Score = 73.2 bits (178), Expect = 2e-12 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQK 138 TMKSLVTGL S+S VAEA EL+GL+KK+ PK+ DMWNDIEA LP+K Sbjct: 359 TMKSLVTGLASISKVAEANELIGLMKKRFPKSGDMWNDIEAALPRK 404 >KDO75487.1 hypothetical protein CISIN_1g041936mg, partial [Citrus sinensis] Length = 402 Score = 71.2 bits (173), Expect = 9e-12 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMKSLVTGL S V+EAKEL+GL+K+K KNVD WN+IEAGLPQ Sbjct: 358 TMKSLVTGLAGASKVSEAKELIGLVKEKFTKNVDTWNEIEAGLPQ 402 >XP_006449054.1 hypothetical protein CICLE_v10015479mg [Citrus clementina] ESR62294.1 hypothetical protein CICLE_v10015479mg [Citrus clementina] Length = 402 Score = 71.2 bits (173), Expect = 9e-12 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMKSLVTGL S V+EAKEL+GL+K+K KNVD WN+IEAGLPQ Sbjct: 358 TMKSLVTGLAGASKVSEAKELIGLVKEKFTKNVDTWNEIEAGLPQ 402 >XP_006468012.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] Length = 402 Score = 70.5 bits (171), Expect = 2e-11 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMKSLVTGL VS V+EAKEL+GL+K+K KNVD W +IEAGLPQ Sbjct: 358 TMKSLVTGLAGVSKVSEAKELIGLVKEKFTKNVDTWKEIEAGLPQ 402 >CBI32989.3 unnamed protein product, partial [Vitis vinifera] Length = 412 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TM SLV GL S+S V EA+EL+G IK+K +NVD WN+IEAGLPQ Sbjct: 368 TMTSLVNGLVSISKVEEARELIGQIKEKFSRNVDKWNEIEAGLPQ 412 >XP_003634851.2 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Vitis vinifera] Length = 422 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TM SLV GL S+S V EA+EL+G IK+K +NVD WN+IEAGLPQ Sbjct: 378 TMTSLVNGLVSISKVEEARELIGQIKEKFSRNVDKWNEIEAGLPQ 422 >CAN77919.1 hypothetical protein VITISV_027645 [Vitis vinifera] Length = 396 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TM SLV GL S+S V EA+EL+G IK+K +NVD WN+IEAGLPQ Sbjct: 352 TMTSLVNGLVSISKVEEAQELIGQIKEKFSRNVDKWNEIEAGLPQ 396 >XP_010101448.1 hypothetical protein L484_012870 [Morus notabilis] EXB88431.1 hypothetical protein L484_012870 [Morus notabilis] Length = 394 Score = 62.8 bits (151), Expect = 9e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMKSLV GL S S V EA+EL+ +K+K NVDMWN+IEAGLPQ Sbjct: 350 TMKSLVEGLVSASRVTEARELISQVKEKFTVNVDMWNEIEAGLPQ 394 >XP_011652746.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Cucumis sativus] KGN64535.1 hypothetical protein Csa_1G063590 [Cucumis sativus] Length = 405 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMKSLV GL S+S V EAK+L+G IK++ KNV+ W++IEAGLPQ Sbjct: 361 TMKSLVDGLVSISKVEEAKQLIGQIKERFSKNVEKWSEIEAGLPQ 405 >KJB22838.1 hypothetical protein B456_004G069000 [Gossypium raimondii] Length = 75 Score = 57.4 bits (137), Expect = 2e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGL 129 TMKSLV GL S+S V EAKEL+ +KKK KN D+W++IE GL Sbjct: 32 TMKSLVNGLRSISKVEEAKELIKNVKKKFSKNADLWDEIEKGL 74 >XP_008224804.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Prunus mume] Length = 392 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMKSLV GL S+S V+EA+ELVG +K++ N D WN+IEAGLPQ Sbjct: 348 TMKSLVEGLVSISKVSEARELVGQMKERFTVNQDQWNEIEAGLPQ 392 >XP_002305587.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE86098.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 359 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMK LV GL S V +AKEL+G IK+K KNV++WN++EAGLPQ Sbjct: 315 TMKMLVEGLASSGNVEKAKELIGEIKEKFSKNVELWNEVEAGLPQ 359 >KDO75485.1 hypothetical protein CISIN_1g015765mg [Citrus sinensis] KDO75486.1 hypothetical protein CISIN_1g015765mg [Citrus sinensis] Length = 401 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQK 138 TMKSLVTGL S+S VAEA EL+GL+KK+ PK+ DMWN A LP++ Sbjct: 359 TMKSLVTGLASISKVAEANELIGLMKKRFPKSGDMWN---AALPRQ 401 >XP_006468013.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] XP_006468014.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] XP_015382221.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] XP_015382230.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] XP_015382234.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Citrus sinensis] Length = 401 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQK 138 TMKSLVTGL S+S VAEA EL+GL+KK+ PK+ DMWN A LP++ Sbjct: 359 TMKSLVTGLASISKVAEANELIGLMKKRFPKSGDMWN---AALPRQ 401 >XP_011037679.1 PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial [Populus euphratica] Length = 404 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 1 TMKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 TMK LV GL S V +AKEL+G IK+K KNV++WN++EAGLPQ Sbjct: 360 TMKMLVEGLASSGNVEKAKELIGEIKEKFSKNVELWNEVEAGLPQ 404 >XP_010476095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11630, mitochondrial-like [Camelina sativa] Length = 404 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +1 Query: 4 MKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 MK LV GL SVS V+EAKEL+ L+K+K +NVD+W ++EA LPQ Sbjct: 361 MKWLVNGLASVSKVSEAKELIALVKEKFTRNVDLWKEVEAALPQ 404 >XP_006307697.1 hypothetical protein CARUB_v10009327mg [Capsella rubella] EOA40595.1 hypothetical protein CARUB_v10009327mg [Capsella rubella] Length = 403 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +1 Query: 4 MKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 MK LV GL S+S V EAKEL+ L+K+K +NVD+W ++EA LPQ Sbjct: 360 MKWLVNGLASLSKVGEAKELIALVKRKFTRNVDLWKEVEAALPQ 403 >XP_002892652.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] EFH68911.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 403 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +1 Query: 4 MKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 MK LV GL SVS V EAKEL+ +K+K +NVD+WN++EA LPQ Sbjct: 360 MKWLVNGLASVSKVDEAKELIAQVKEKFTRNVDLWNEVEAALPQ 403 >JAU95992.1 Pentatricopeptide repeat-containing protein, mitochondrial [Noccaea caerulescens] Length = 409 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +1 Query: 4 MKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 MKSLV GL S V EAKEL+G +K K +NV++WN++EA LPQ Sbjct: 366 MKSLVNGLAKASKVEEAKELIGQVKDKFTRNVELWNEVEAALPQ 409 >JAU56535.1 Pentatricopeptide repeat-containing protein, mitochondrial [Noccaea caerulescens] Length = 409 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +1 Query: 4 MKSLVTGLGSVSMVAEAKELVGLIKKKIPKNVDMWNDIEAGLPQ 135 MKSLV GL S V EAKEL+G +K K +NV++WN++EA LPQ Sbjct: 366 MKSLVNGLAKASKVEEAKELIGQVKDKFTRNVELWNEVEAALPQ 409