BLASTX nr result
ID: Phellodendron21_contig00023547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023547 (636 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIM84845.1 hypothetical protein PILCRDRAFT_87227 [Piloderma croc... 55 8e-06 >KIM84845.1 hypothetical protein PILCRDRAFT_87227 [Piloderma croceum F 1598] Length = 204 Score = 55.1 bits (131), Expect = 8e-06 Identities = 28/92 (30%), Positives = 42/92 (45%) Frame = -1 Query: 408 NIPKNLTTCVPVEISWTGGKPSYSAFLYQREKETNPVVVEDLGQHDGTNLVWTPTQLGGE 229 N P N C P +++WTGG P Y ++ + T +EDLGQ + T W G Sbjct: 22 NTPSNPVECQPTQLTWTGGSPPYFLSIFPGGEPTG-TALEDLGQQNATQFTWIADLAAGT 80 Query: 228 PNAERFILIKDKDGLIANSSSFYVQLNPNEAC 133 +KD GL+A S + +Q + +C Sbjct: 81 SCG---FSLKDSTGLLAQSGTVTIQAGTSTSC 109