BLASTX nr result
ID: Phellodendron21_contig00023484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023484 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410826.1 hypothetical protein MELLADRAFT_116699 [Melampsor... 63 2e-08 >XP_007410826.1 hypothetical protein MELLADRAFT_116699 [Melampsora larici-populina 98AG31] EGG05770.1 hypothetical protein MELLADRAFT_116699 [Melampsora larici-populina 98AG31] Length = 742 Score = 62.8 bits (151), Expect = 2e-08 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 2/82 (2%) Frame = +3 Query: 42 EFFVPELLVFRCPREIRDHTNIRSPAPHSGQMRPYPNHIPIVTLGRGKKNRRNIDEMSRA 221 ++ +P L VF P + D I +P QM YP+ IPIVTLGRGKKN R++ EMS Sbjct: 183 QYNIPPLQVFTRPLGMEDDPLIEH-SPRLSQMMRYPDEIPIVTLGRGKKNTRSLIEMSEG 241 Query: 222 EQKKALEG--PTTDQNSREQES 281 E ++AL G P+ + +++Q++ Sbjct: 242 EMEEALHGLNPSQSRQAKQQQA 263