BLASTX nr result
ID: Phellodendron21_contig00023134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00023134 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008464647.1 PREDICTED: uncharacterized protein LOC103502484 [... 70 2e-13 OAY75003.1 putative polyamine oxidase 2 [Ananas comosus] 64 7e-09 >XP_008464647.1 PREDICTED: uncharacterized protein LOC103502484 [Cucumis melo] Length = 67 Score = 70.5 bits (171), Expect = 2e-13 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -3 Query: 300 MSWLGKLGFYFLSSNSNHFITCLLIFILHYSPQLPPSLFNFEKKATE 160 M+ LGKLG LSSNSNHFITCLL+F+LHYSPQL PSLFNF+ K+ + Sbjct: 1 MNCLGKLGLN-LSSNSNHFITCLLLFLLHYSPQLTPSLFNFDYKSID 46 >OAY75003.1 putative polyamine oxidase 2 [Ananas comosus] Length = 512 Score = 63.5 bits (153), Expect = 7e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 300 MSWLGKLGFYFLSSNSNHFITCLLIFILHYSPQLPPSLFN 181 M+W LG L+SNSNHFITCLLIF+LHYSPQLPPS+ N Sbjct: 1 MNWFVNLG---LNSNSNHFITCLLIFVLHYSPQLPPSILN 37