BLASTX nr result
ID: Phellodendron21_contig00022873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00022873 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006422144.1 hypothetical protein CICLE_v10005301mg [Citrus cl... 68 6e-11 >XP_006422144.1 hypothetical protein CICLE_v10005301mg [Citrus clementina] ESR35384.1 hypothetical protein CICLE_v10005301mg [Citrus clementina] KDO56088.1 hypothetical protein CISIN_1g018672mg [Citrus sinensis] Length = 270 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +2 Query: 200 KLAFQLVIYMHVTDGKRHAINNSSYHVNLDCYKYG 304 +++FQLVIYMHVTDGKRHAI+NSSYHVNLD YKYG Sbjct: 12 EVSFQLVIYMHVTDGKRHAISNSSYHVNLDRYKYG 46