BLASTX nr result
ID: Phellodendron21_contig00022768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00022768 (567 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016201976.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 89 1e-19 XP_015964250.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 89 1e-19 XP_015964238.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 89 1e-19 XP_010033471.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 89 1e-19 OAY57519.1 hypothetical protein MANES_02G103000 [Manihot esculenta] 88 3e-19 XP_018822042.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 88 3e-19 XP_002269631.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 88 4e-19 KCW53116.1 hypothetical protein EUGRSUZ_J02408, partial [Eucalyp... 89 6e-19 XP_017981503.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 87 6e-19 XP_016698619.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 87 6e-19 OAY60852.1 hypothetical protein MANES_01G144800 [Manihot esculenta] 87 8e-19 XP_018805495.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 87 9e-19 XP_011088541.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 87 1e-18 XP_008222450.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 87 1e-18 XP_015889649.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 86 2e-18 XP_012065595.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 86 2e-18 XP_007225834.1 hypothetical protein PRUPE_ppa013466mg [Prunus pe... 86 2e-18 EOX90884.1 Peptidylprolyl cis/trans isomerase [Theobroma cacao] 87 3e-18 XP_016539863.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pi... 86 3e-18 Q9LEK8.1 RecName: Full=Peptidyl-prolyl cis-trans isomerase Pin1;... 86 3e-18 >XP_016201976.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Arachis ipaensis] Length = 127 Score = 89.4 bits (220), Expect = 1e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 85 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >XP_015964250.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Arachis duranensis] Length = 127 Score = 89.4 bits (220), Expect = 1e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 85 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >XP_015964238.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Arachis duranensis] XP_016201948.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Arachis ipaensis] Length = 127 Score = 89.4 bits (220), Expect = 1e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 85 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >XP_010033471.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Eucalyptus grandis] Length = 127 Score = 89.4 bits (220), Expect = 1e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 85 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >OAY57519.1 hypothetical protein MANES_02G103000 [Manihot esculenta] Length = 119 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE+ATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 77 DLGPFGRGQMQKPFEDATYALKVGEISDIVDTDSGVHIIMRTG 119 >XP_018822042.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Juglans regia] Length = 122 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHII+RTG Sbjct: 80 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIILRTG 122 >XP_002269631.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Vitis vinifera] CBI17392.3 unnamed protein product, partial [Vitis vinifera] Length = 118 Score = 87.8 bits (216), Expect = 4e-19 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+V+TDSGVHIIMRTG Sbjct: 76 DLGPFGRGQMQKPFEEATYALKVGEISDIVETDSGVHIIMRTG 118 >KCW53116.1 hypothetical protein EUGRSUZ_J02408, partial [Eucalyptus grandis] Length = 189 Score = 89.4 bits (220), Expect = 6e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 147 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 189 >XP_017981503.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Theobroma cacao] Length = 122 Score = 87.4 bits (215), Expect = 6e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE ATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 80 DLGPFGRGQMQKPFENATYALKVGEISDIVDTDSGVHIIMRTG 122 >XP_016698619.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Gossypium hirsutum] Length = 122 Score = 87.4 bits (215), Expect = 6e-19 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE+ATY+LKIGE+SD+VDTDSGVHIIMRTG Sbjct: 80 DLGPFGRGQMQKPFEDATYSLKIGEISDIVDTDSGVHIIMRTG 122 >OAY60852.1 hypothetical protein MANES_01G144800 [Manihot esculenta] Length = 119 Score = 87.0 bits (214), Expect = 8e-19 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE+AT+ALKIGE+SD+VDTDSGVHIIMRTG Sbjct: 77 DLGPFGRGQMQKPFEDATFALKIGEISDIVDTDSGVHIIMRTG 119 >XP_018805495.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 isoform X2 [Juglans regia] Length = 123 Score = 87.0 bits (214), Expect = 9e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEATYALK+GE+SD+VDTDSGVHII RTG Sbjct: 81 DLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIKRTG 123 >XP_011088541.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Sesamum indicum] Length = 119 Score = 86.7 bits (213), Expect = 1e-18 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE+ATY LK+GE+SD+VDTDSGVHIIMRTG Sbjct: 77 DLGPFGRGQMQKPFEDATYGLKVGEISDIVDTDSGVHIIMRTG 119 >XP_008222450.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Prunus mume] XP_008222451.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Prunus mume] Length = 121 Score = 86.7 bits (213), Expect = 1e-18 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFG+GQMQKPFEEAT+ALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 79 DLGPFGKGQMQKPFEEATFALKVGEISDIVDTDSGVHIIMRTG 121 >XP_015889649.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Ziziphus jujuba] Length = 119 Score = 86.3 bits (212), Expect = 2e-18 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEAT+A+KIGE+SD+VDTDSGVHII+RTG Sbjct: 77 DLGPFGRGQMQKPFEEATFAIKIGEISDIVDTDSGVHIILRTG 119 >XP_012065595.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Jatropha curcas] KDP46719.1 hypothetical protein JCGZ_06507 [Jatropha curcas] Length = 119 Score = 86.3 bits (212), Expect = 2e-18 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE+ATYALK+GE+S++VDTDSGVHI+MRTG Sbjct: 77 DLGPFGRGQMQKPFEDATYALKVGEISEIVDTDSGVHIVMRTG 119 >XP_007225834.1 hypothetical protein PRUPE_ppa013466mg [Prunus persica] XP_007225835.1 hypothetical protein PRUPE_ppa013466mg [Prunus persica] ONI29573.1 hypothetical protein PRUPE_1G202600 [Prunus persica] ONI29574.1 hypothetical protein PRUPE_1G202600 [Prunus persica] Length = 121 Score = 85.9 bits (211), Expect = 2e-18 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFG+GQMQKPFEEAT+ALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 79 DLGPFGKGQMQKPFEEATFALKVGEMSDIVDTDSGVHIIMRTG 121 >EOX90884.1 Peptidylprolyl cis/trans isomerase [Theobroma cacao] Length = 183 Score = 87.4 bits (215), Expect = 3e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE ATYALK+GE+SD+VDTDSGVHIIMRTG Sbjct: 141 DLGPFGRGQMQKPFENATYALKVGEISDIVDTDSGVHIIMRTG 183 >XP_016539863.1 PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Capsicum annuum] Length = 118 Score = 85.5 bits (210), Expect = 3e-18 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFE+ATY LK+GEVSD++DTDSGVHII+RTG Sbjct: 76 DLGPFGRGQMQKPFEDATYVLKVGEVSDIIDTDSGVHIILRTG 118 >Q9LEK8.1 RecName: Full=Peptidyl-prolyl cis-trans isomerase Pin1; Short=PPIase Pin1; AltName: Full=DlPar13; AltName: Full=Rotamase Pin1 CAB94994.1 peptidyl-prolyl cis-trans isomerase [Digitalis lanata] Length = 118 Score = 85.5 bits (210), Expect = 3e-18 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 567 DLGPFGRGQMQKPFEEATYALKIGEVSDVVDTDSGVHIIMRTG 439 DLGPFGRGQMQKPFEEAT+ALK+GE+SD+VDTDSGVHII RTG Sbjct: 76 DLGPFGRGQMQKPFEEATFALKVGEISDIVDTDSGVHIIKRTG 118