BLASTX nr result
ID: Phellodendron21_contig00022594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00022594 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO46478.1 hypothetical protein CISIN_1g0023101mg, partial [Citr... 56 2e-06 XP_006423887.1 hypothetical protein CICLE_v10030175mg, partial [... 54 1e-05 >KDO46478.1 hypothetical protein CISIN_1g0023101mg, partial [Citrus sinensis] KDO46479.1 hypothetical protein CISIN_1g0023101mg, partial [Citrus sinensis] Length = 395 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = -1 Query: 269 RHFFKRISNTHRP---TSISAITLPFASRSRTSLCAVLPPQVRCRVDCM 132 RHF KRI +R TSIS TLPFAS SR AVLPP +RCR++CM Sbjct: 23 RHFLKRIPMAYRIQPLTSISTQTLPFASLSRRKFSAVLPPHIRCRLECM 71 >XP_006423887.1 hypothetical protein CICLE_v10030175mg, partial [Citrus clementina] ESR37127.1 hypothetical protein CICLE_v10030175mg, partial [Citrus clementina] Length = 394 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = -1 Query: 269 RHFFKRISNTHRP---TSISAITLPFASRSRTSLCAVLPPQVRCRVDCM 132 RHF KR+ +R TSIS TLP AS SR AVLPP +RCR++CM Sbjct: 23 RHFLKRVPTAYRIRPLTSISTQTLPLASLSRRKFSAVLPPHIRCRLECM 71