BLASTX nr result
ID: Phellodendron21_contig00022535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00022535 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444278.1 hypothetical protein CICLE_v10023157mg [Citrus cl... 52 5e-07 >XP_006444278.1 hypothetical protein CICLE_v10023157mg [Citrus clementina] ESR57518.1 hypothetical protein CICLE_v10023157mg [Citrus clementina] KDO87308.1 hypothetical protein CISIN_1g034981mg [Citrus sinensis] Length = 77 Score = 52.4 bits (124), Expect = 5e-07 Identities = 25/30 (83%), Positives = 26/30 (86%), Gaps = 4/30 (13%) Frame = -2 Query: 266 INRGIERRKP----EDPIRTLMFLGSWSHT 189 INRGIERRKP EDPIRT+MFLGSWSHT Sbjct: 48 INRGIERRKPSYRAEDPIRTIMFLGSWSHT 77