BLASTX nr result
ID: Phellodendron21_contig00022383
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00022383 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006430064.1 hypothetical protein CICLE_v10011935mg [Citrus cl... 64 7e-12 XP_006481597.1 PREDICTED: uncharacterized protein LOC102625635 [... 64 1e-09 KDO70610.1 hypothetical protein CISIN_1g025306mg [Citrus sinensis] 59 6e-08 XP_002309251.2 hypothetical protein POPTR_0006s21980g [Populus t... 59 1e-07 XP_010247110.1 PREDICTED: uncharacterized protein LOC104590234 [... 56 6e-07 EOY08475.1 NC domain-containing protein-related isoform 1 [Theob... 56 1e-06 XP_008442917.1 PREDICTED: uncharacterized protein LOC103486679 [... 55 2e-06 XP_004136514.1 PREDICTED: uncharacterized protein LOC101207710 [... 55 2e-06 KMZ65122.1 NC domain-containing protein-related [Zostera marina] 55 2e-06 XP_011046416.1 PREDICTED: uncharacterized protein LOC105141034 [... 55 2e-06 XP_002266364.1 PREDICTED: uncharacterized protein LOC100260806 [... 54 3e-06 KZM99197.1 hypothetical protein DCAR_013441 [Daucus carota subsp... 53 5e-06 OAY42995.1 hypothetical protein MANES_08G033600 [Manihot esculenta] 54 6e-06 XP_010491195.1 PREDICTED: uncharacterized protein LOC104768831 [... 54 6e-06 KJB36263.1 hypothetical protein B456_006G149300 [Gossypium raimo... 53 7e-06 XP_012485743.1 PREDICTED: uncharacterized protein LOC105799622 [... 53 8e-06 XP_017977291.1 PREDICTED: uncharacterized protein LOC18598402 [T... 53 8e-06 XP_002533900.1 PREDICTED: uncharacterized protein LOC8263555 [Ri... 53 8e-06 XP_017243953.1 PREDICTED: uncharacterized protein LOC108215866 [... 53 8e-06 XP_016184694.1 PREDICTED: uncharacterized protein LOC107626343 [... 53 8e-06 >XP_006430064.1 hypothetical protein CICLE_v10011935mg [Citrus clementina] ESR43304.1 hypothetical protein CICLE_v10011935mg [Citrus clementina] Length = 389 Score = 64.3 bits (155), Expect(2) = 7e-12 Identities = 40/77 (51%), Positives = 48/77 (62%), Gaps = 11/77 (14%) Frame = -1 Query: 199 TCKTHTRSTK-------FRPGFKLLNRAIEFSNKIQ*Y*KSSVETE----MGLLSNRINK 53 TCKT TR + FR +++I+F N SS+E E MGLLSNRI+K Sbjct: 88 TCKTRTRQAESLLLDFNFRTQE---SKSIKFPNTKTKNKLSSLEREREREMGLLSNRIDK 144 Query: 52 ESLKPGDHIYSWRAYIY 2 ESLKPGDHIYSWRAY+Y Sbjct: 145 ESLKPGDHIYSWRAYVY 161 Score = 33.1 bits (74), Expect(2) = 7e-12 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = -3 Query: 335 QMPKRYVPRAQNPATAVSLLPFPTKLFTKGHNRQFTEHGALF 210 + P R +PR N T + + TKL GHNRQFT+ A F Sbjct: 45 ECPHRPLPRVHNHGTCL-FVALRTKLSDGGHNRQFTKRQAPF 85 >XP_006481597.1 PREDICTED: uncharacterized protein LOC102625635 [Citrus sinensis] Length = 321 Score = 64.3 bits (155), Expect = 1e-09 Identities = 40/77 (51%), Positives = 48/77 (62%), Gaps = 11/77 (14%) Frame = -1 Query: 199 TCKTHTRSTK-------FRPGFKLLNRAIEFSNKIQ*Y*KSSVETE----MGLLSNRINK 53 TCKT TR + FR +++I+F N SS+E E MGLLSNRI+K Sbjct: 20 TCKTRTRQAESLLLDFNFRTQE---SKSIKFPNTKTKNKLSSLEREREREMGLLSNRIDK 76 Query: 52 ESLKPGDHIYSWRAYIY 2 ESLKPGDHIYSWRAY+Y Sbjct: 77 ESLKPGDHIYSWRAYVY 93 >KDO70610.1 hypothetical protein CISIN_1g025306mg [Citrus sinensis] Length = 255 Score = 58.9 bits (141), Expect = 6e-08 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWRAYIY 2 MGLLSNRI+KESLKPGDHIYSWRAY+Y Sbjct: 1 MGLLSNRIDKESLKPGDHIYSWRAYVY 27 >XP_002309251.2 hypothetical protein POPTR_0006s21980g [Populus trichocarpa] EEE92774.2 hypothetical protein POPTR_0006s21980g [Populus trichocarpa] Length = 306 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = -1 Query: 94 VETEMGLLSNRINKESLKPGDHIYSWR-AYIY 2 VE +MGLLSNRI+KESLKPGDHIYSWR AYIY Sbjct: 43 VERDMGLLSNRISKESLKPGDHIYSWRTAYIY 74 >XP_010247110.1 PREDICTED: uncharacterized protein LOC104590234 [Nelumbo nucifera] Length = 258 Score = 56.2 bits (134), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRINKESLKPGDHIYSWR AY+Y Sbjct: 1 MGLLSNRINKESLKPGDHIYSWRTAYVY 28 >EOY08475.1 NC domain-containing protein-related isoform 1 [Theobroma cacao] Length = 338 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -1 Query: 91 ETEMGLLSNRINKESLKPGDHIYSWR-AYIY 2 +T MGLLSNR+ KESLKPGDHIYSWR AYIY Sbjct: 70 DTNMGLLSNRVAKESLKPGDHIYSWRTAYIY 100 >XP_008442917.1 PREDICTED: uncharacterized protein LOC103486679 [Cucumis melo] Length = 264 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR+N+ESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVNRESLKPGDHIYSWRAAYIY 28 >XP_004136514.1 PREDICTED: uncharacterized protein LOC101207710 [Cucumis sativus] KGN59209.1 hypothetical protein Csa_3G781590 [Cucumis sativus] Length = 264 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR+N+ESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVNRESLKPGDHIYSWRAAYIY 28 >KMZ65122.1 NC domain-containing protein-related [Zostera marina] Length = 249 Score = 54.7 bits (130), Expect = 2e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWRAYIY 2 MGL SNRI KESLKPGDHIYSWR Y+Y Sbjct: 1 MGLFSNRIPKESLKPGDHIYSWRVYVY 27 >XP_011046416.1 PREDICTED: uncharacterized protein LOC105141034 [Populus euphratica] Length = 259 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRI+KESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRISKESLKPGDHIYSWRTAYIY 28 >XP_002266364.1 PREDICTED: uncharacterized protein LOC100260806 [Vitis vinifera] CBI22789.3 unnamed protein product, partial [Vitis vinifera] Length = 262 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR++KESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVDKESLKPGDHIYSWRTAYIY 28 >KZM99197.1 hypothetical protein DCAR_013441 [Daucus carota subsp. sativus] Length = 194 Score = 53.1 bits (126), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR+++ESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVDRESLKPGDHIYSWRNAYIY 28 >OAY42995.1 hypothetical protein MANES_08G033600 [Manihot esculenta] Length = 258 Score = 53.5 bits (127), Expect = 6e-06 Identities = 26/28 (92%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRI KESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRIAKESLKPGDHIYSWRAAYIY 28 >XP_010491195.1 PREDICTED: uncharacterized protein LOC104768831 [Camelina sativa] Length = 259 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRIN+ SLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRINRSSLKPGDHIYSWRTAYIY 28 >KJB36263.1 hypothetical protein B456_006G149300 [Gossypium raimondii] Length = 231 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRI+K+SLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRIDKKSLKPGDHIYSWRTAYIY 28 >XP_012485743.1 PREDICTED: uncharacterized protein LOC105799622 [Gossypium raimondii] XP_016671386.1 PREDICTED: uncharacterized protein LOC107891188 [Gossypium hirsutum] KJB36262.1 hypothetical protein B456_006G149300 [Gossypium raimondii] Length = 255 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRI+K+SLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRIDKKSLKPGDHIYSWRTAYIY 28 >XP_017977291.1 PREDICTED: uncharacterized protein LOC18598402 [Theobroma cacao] Length = 256 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR+ KESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVAKESLKPGDHIYSWRTAYIY 28 >XP_002533900.1 PREDICTED: uncharacterized protein LOC8263555 [Ricinus communis] EEF28482.1 conserved hypothetical protein [Ricinus communis] Length = 256 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNRI++ESLKPGDHIYSWR AY+Y Sbjct: 1 MGLLSNRISRESLKPGDHIYSWRAAYVY 28 >XP_017243953.1 PREDICTED: uncharacterized protein LOC108215866 [Daucus carota subsp. sativus] Length = 257 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR+++ESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVDRESLKPGDHIYSWRNAYIY 28 >XP_016184694.1 PREDICTED: uncharacterized protein LOC107626343 [Arachis ipaensis] Length = 270 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%), Gaps = 1/28 (3%) Frame = -1 Query: 82 MGLLSNRINKESLKPGDHIYSWR-AYIY 2 MGLLSNR+++ESLKPGDHIYSWR AYIY Sbjct: 1 MGLLSNRVSRESLKPGDHIYSWRTAYIY 28