BLASTX nr result
ID: Phellodendron21_contig00022337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00022337 (705 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007409383.1 hypothetical protein MELLADRAFT_105862 [Melampsor... 88 8e-17 >XP_007409383.1 hypothetical protein MELLADRAFT_105862 [Melampsora larici-populina 98AG31] EGG07476.1 hypothetical protein MELLADRAFT_105862 [Melampsora larici-populina 98AG31] Length = 334 Score = 87.8 bits (216), Expect = 8e-17 Identities = 53/132 (40%), Positives = 76/132 (57%), Gaps = 13/132 (9%) Frame = -3 Query: 406 MADSWPFLHLNLLSPDLSSKHLSLNTT---NLQDVALNSSELNRQLEAWTNIDFNFDIDP 236 MA WPFLHLNLLSP+ SS+ LS N + QD++L+S EL+RQLEAWTNIDFNFD+DP Sbjct: 1 MATDWPFLHLNLLSPNPSSRELSNNLNPNQSPQDLSLHSIELDRQLEAWTNIDFNFDLDP 60 Query: 235 VSDPHPSKPSLAFS----------SCDSLESVAGSTGSYDQLFDYPADKSYLQQPSPSSA 86 ++ + P+ + D + + ++ ++D+LF + PS Sbjct: 61 ITTTDTNLPNHHHHHHGLNHHHGLNTDLNQPLNETSKTFDELFSF-----------PSPN 109 Query: 85 YVVPTNPTSLHH 50 + PT+PT HH Sbjct: 110 FFQPTDPT--HH 119