BLASTX nr result
ID: Phellodendron21_contig00021930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021930 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007407063.1 hypothetical protein MELLADRAFT_47283 [Melampsora... 72 2e-12 XP_003320159.1 adenylate kinase [Puccinia graminis f. sp. tritic... 64 3e-09 OAV93693.1 hypothetical protein PTTG_06589 [Puccinia triticina 1... 58 2e-07 KNZ62136.1 adenylate kinase [Puccinia sorghi] 57 7e-07 KNE98861.1 adenylate kinase [Puccinia striiformis f. sp. tritici... 56 1e-06 >XP_007407063.1 hypothetical protein MELLADRAFT_47283 [Melampsora larici-populina 98AG31] EGG10009.1 hypothetical protein MELLADRAFT_47283 [Melampsora larici-populina 98AG31] Length = 312 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 392 AAYYKKKAIWVGIDAAQSPNTVWNSLLDAFKNCQMSSDEKK 270 A YYKKK IWVG+DAAQSP+TVW+SLLDAFKNC +D KK Sbjct: 272 AGYYKKKGIWVGVDAAQSPSTVWSSLLDAFKNCHKPNDTKK 312 >XP_003320159.1 adenylate kinase [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP75740.1 adenylate kinase [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 345 Score = 63.5 bits (153), Expect = 3e-09 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 392 AAYYKKKAIWVGIDAAQSPNTVWNSLLDAFKNCQMSSDEKKASR 261 A YYKK+ IWVG+DAAQS TVWNSLLDAFKNC ++ A + Sbjct: 302 AQYYKKRGIWVGVDAAQSQLTVWNSLLDAFKNCHEKQKQQGARK 345 >OAV93693.1 hypothetical protein PTTG_06589 [Puccinia triticina 1-1 BBBD Race 1] Length = 398 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -2 Query: 392 AAYYKKKAIWVGIDAAQSPNTVWNSLLDAFKNC 294 A YYKK+ IWVG+DAAQS TVWNSLL AFK C Sbjct: 356 AQYYKKRGIWVGVDAAQSQTTVWNSLLAAFKKC 388 >KNZ62136.1 adenylate kinase [Puccinia sorghi] Length = 304 Score = 56.6 bits (135), Expect = 7e-07 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 392 AAYYKKKAIWVGIDAAQSPNTVWNSLLDAFKNCQMSSDEKKASR 261 A YYK++ IWVG+DAAQS TVWNSLL AFK+C +K SR Sbjct: 262 AQYYKQRGIWVGVDAAQSQATVWNSLLAAFKDCH--EKQKNESR 303 >KNE98861.1 adenylate kinase [Puccinia striiformis f. sp. tritici PST-78] Length = 305 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -2 Query: 392 AAYYKKKAIWVGIDAAQSPNTVWNSLLDAFKNC 294 A YYK+K IWVG+DAAQS TVW SLL AFK+C Sbjct: 262 AQYYKQKGIWVGVDAAQSQATVWKSLLSAFKDC 294