BLASTX nr result
ID: Phellodendron21_contig00021843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021843 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007411203.1 hypothetical protein MELLADRAFT_36667 [Melampsora... 65 8e-11 OAV93050.1 hypothetical protein PTTG_02846 [Puccinia triticina 1... 56 9e-07 XP_003321647.1 hypothetical protein PGTG_03184 [Puccinia gramini... 54 4e-06 >XP_007411203.1 hypothetical protein MELLADRAFT_36667 [Melampsora larici-populina 98AG31] EGG05714.1 hypothetical protein MELLADRAFT_36667, partial [Melampsora larici-populina 98AG31] Length = 169 Score = 65.5 bits (158), Expect = 8e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 372 KGDVEGAKKLYQKSISMKPSSTAYYNLGITLYQLKQ 265 KGD+EGAK LY+KSIS+KP+ST+YYNLGITLYQLK+ Sbjct: 31 KGDIEGAKDLYEKSISIKPTSTSYYNLGITLYQLKK 66 >OAV93050.1 hypothetical protein PTTG_02846 [Puccinia triticina 1-1 BBBD Race 1] Length = 249 Score = 55.8 bits (133), Expect = 9e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 372 KGDVEGAKKLYQKSISMKPSSTAYYNLGITLYQLKQ 265 KGD+EGA + Y++SI+M PSST YYNLGI LYQLK+ Sbjct: 98 KGDLEGALEKYEESIAMAPSSTGYYNLGIALYQLKR 133 >XP_003321647.1 hypothetical protein PGTG_03184 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP77228.1 hypothetical protein PGTG_03184 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 239 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 372 KGDVEGAKKLYQKSISMKPSSTAYYNLGITLYQLKQ 265 KGD+EGA + Y++ I+M PSST YYNLGI LYQLK+ Sbjct: 88 KGDLEGALEKYEEGIAMVPSSTGYYNLGIALYQLKR 123