BLASTX nr result
ID: Phellodendron21_contig00021686
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021686 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006437751.1 hypothetical protein CICLE_v10031108mg [Citrus cl... 62 2e-09 XP_006484397.1 PREDICTED: uncharacterized protein LOC102618545 [... 62 2e-09 XP_006437752.1 hypothetical protein CICLE_v10031108mg [Citrus cl... 62 2e-09 >XP_006437751.1 hypothetical protein CICLE_v10031108mg [Citrus clementina] ESR50991.1 hypothetical protein CICLE_v10031108mg [Citrus clementina] Length = 534 Score = 62.4 bits (150), Expect = 2e-09 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = +2 Query: 110 MSASATATTIPQFFLVRRRIDNLSVFTSPRSHLRPRNSKLLRRLSVSASL 259 MS+S + T P F LVRRRIDNLS P SHLRPR SKLL RLSVSASL Sbjct: 1 MSSSTSTATTPPFLLVRRRIDNLS----PTSHLRPRKSKLLGRLSVSASL 46 >XP_006484397.1 PREDICTED: uncharacterized protein LOC102618545 [Citrus sinensis] Length = 564 Score = 62.4 bits (150), Expect = 2e-09 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = +2 Query: 110 MSASATATTIPQFFLVRRRIDNLSVFTSPRSHLRPRNSKLLRRLSVSASL 259 MS+S + T P F LVRRRIDNLS P SHLRPR SKLL RLSVSASL Sbjct: 1 MSSSTSTATTPPFLLVRRRIDNLS----PTSHLRPRKSKLLGRLSVSASL 46 >XP_006437752.1 hypothetical protein CICLE_v10031108mg [Citrus clementina] ESR50992.1 hypothetical protein CICLE_v10031108mg [Citrus clementina] Length = 564 Score = 62.4 bits (150), Expect = 2e-09 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = +2 Query: 110 MSASATATTIPQFFLVRRRIDNLSVFTSPRSHLRPRNSKLLRRLSVSASL 259 MS+S + T P F LVRRRIDNLS P SHLRPR SKLL RLSVSASL Sbjct: 1 MSSSTSTATTPPFLLVRRRIDNLS----PTSHLRPRKSKLLGRLSVSASL 46