BLASTX nr result
ID: Phellodendron21_contig00021677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021677 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006443624.1 hypothetical protein CICLE_v10019729mg [Citrus cl... 65 3e-10 >XP_006443624.1 hypothetical protein CICLE_v10019729mg [Citrus clementina] XP_006479307.1 PREDICTED: uncharacterized protein LOC102622670 [Citrus sinensis] ESR56864.1 hypothetical protein CICLE_v10019729mg [Citrus clementina] Length = 519 Score = 65.5 bits (158), Expect = 3e-10 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 127 MAEYLALPSCFKLRMQRICVKEGGGGCLPRNSPFRAVL--RTCY 2 MAEYLALPSC KL MQRI KE GG C+PRNSPFRA L RT Y Sbjct: 1 MAEYLALPSCIKLHMQRISAKEEGGRCVPRNSPFRATLSCRTFY 44