BLASTX nr result
ID: Phellodendron21_contig00021534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021534 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007406027.1 hypothetical protein MELLADRAFT_47091 [Melampsora... 80 3e-15 XP_003889300.1 hypothetical protein PGTG_22007 [Puccinia gramini... 66 2e-10 KNE95783.1 hypothetical protein PSTG_10844 [Puccinia striiformis... 66 2e-10 >XP_007406027.1 hypothetical protein MELLADRAFT_47091 [Melampsora larici-populina 98AG31] EGG10558.1 hypothetical protein MELLADRAFT_47091 [Melampsora larici-populina 98AG31] Length = 1140 Score = 79.7 bits (195), Expect = 3e-15 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 318 EKCMQAGMSGVCTKPLSAPELLAAMTKAISLHREYTHVGQIQHNQ 184 EKCM+AGMSGVCTKPL APELLAAMTKAISLHR+Y GQI++NQ Sbjct: 1096 EKCMKAGMSGVCTKPLLAPELLAAMTKAISLHRQYAQFGQIKYNQ 1140 >XP_003889300.1 hypothetical protein PGTG_22007 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EHS64008.1 hypothetical protein PGTG_22007 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 829 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 318 EKCMQAGMSGVCTKPLSAPELLAAMTKAISLHREYTHV 205 EKCM+AGMSGVCTKPL APELLAAM+KAISLHR++ + Sbjct: 785 EKCMKAGMSGVCTKPLLAPELLAAMSKAISLHRQFARL 822 >KNE95783.1 hypothetical protein PSTG_10844 [Puccinia striiformis f. sp. tritici PST-78] Length = 1442 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 318 EKCMQAGMSGVCTKPLSAPELLAAMTKAISLHREYTHV 205 EKCM+AGMSGVCTKPL APELLAAM+KAISLHR++ + Sbjct: 1397 EKCMKAGMSGVCTKPLLAPELLAAMSKAISLHRQFARL 1434