BLASTX nr result
ID: Phellodendron21_contig00021369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021369 (752 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF39263.1 conserved hypothetical protein [Ricinus communis] 70 1e-12 >EEF39263.1 conserved hypothetical protein [Ricinus communis] Length = 62 Score = 70.5 bits (171), Expect = 1e-12 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +2 Query: 287 EGNGDLDLDRDLQKFQKQSKFKIHSFLFKNFHPRALCLFHVKSLPYLKGIKRQKENL 457 +G+GDLDL+RDLQKFQKQ KFKIH+FLF NFHPRAL +S K KR+ NL Sbjct: 7 DGSGDLDLERDLQKFQKQPKFKIHTFLFNNFHPRALMPLPRQSYQIQKD-KRKSHNL 62