BLASTX nr result
ID: Phellodendron21_contig00021352
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021352 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006421655.1 hypothetical protein CICLE_v10005768mg [Citrus cl... 96 2e-22 XP_006421654.1 hypothetical protein CICLE_v10005768mg [Citrus cl... 96 4e-22 KDO65517.1 hypothetical protein CISIN_1g026575mg [Citrus sinensis] 93 3e-21 KDO65513.1 hypothetical protein CISIN_1g026575mg [Citrus sinensi... 93 6e-21 XP_006490124.1 PREDICTED: cell number regulator 6 [Citrus sinens... 93 6e-21 XP_009613210.1 PREDICTED: cell number regulator 6-like [Nicotian... 76 2e-14 XP_007038376.2 PREDICTED: cell number regulator 6 [Theobroma cacao] 75 2e-14 GAV79129.1 PLAC8 domain-containing protein [Cephalotus follicula... 75 2e-14 XP_009788021.1 PREDICTED: cell number regulator 6-like [Nicotian... 75 3e-14 XP_002510957.1 PREDICTED: cell number regulator 6 [Ricinus commu... 75 3e-14 XP_012090449.1 PREDICTED: cell number regulator 6 [Jatropha curc... 74 7e-14 XP_019245344.1 PREDICTED: cell number regulator 6-like isoform X... 74 8e-14 OAY30508.1 hypothetical protein MANES_14G036200 [Manihot esculenta] 74 1e-13 XP_019245320.1 PREDICTED: cell number regulator 6-like isoform X... 74 1e-13 XP_016462491.1 PREDICTED: cell number regulator 6-like [Nicotian... 73 3e-13 XP_009801117.1 PREDICTED: cell number regulator 6-like [Nicotian... 73 3e-13 XP_009602303.1 PREDICTED: cell number regulator 6-like [Nicotian... 73 3e-13 EOY22877.1 Cell number regulator 6 isoform 1 [Theobroma cacao] E... 72 3e-13 XP_016573333.1 PREDICTED: cell number regulator 6-like [Capsicum... 72 7e-13 XP_006358252.1 PREDICTED: cell number regulator 6 [Solanum tuber... 71 1e-12 >XP_006421655.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] ESR34895.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] Length = 210 Score = 95.9 bits (237), Expect = 2e-22 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMKNHLSDN AMPMTVVNPPPVQEMNSA NQDP+PSSGNGTT+EMQAL Sbjct: 161 REMKNHLSDNVAMPMTVVNPPPVQEMNSAPENQDPAPSSGNGTTMEMQAL 210 >XP_006421654.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] XP_006421656.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] XP_006421657.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] ESR34894.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] ESR34896.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] ESR34897.1 hypothetical protein CICLE_v10005768mg [Citrus clementina] Length = 236 Score = 95.9 bits (237), Expect = 4e-22 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMKNHLSDN AMPMTVVNPPPVQEMNSA NQDP+PSSGNGTT+EMQAL Sbjct: 187 REMKNHLSDNVAMPMTVVNPPPVQEMNSAPENQDPAPSSGNGTTMEMQAL 236 >KDO65517.1 hypothetical protein CISIN_1g026575mg [Citrus sinensis] Length = 210 Score = 92.8 bits (229), Expect = 3e-21 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMKN LSDN AMPMTVVNPPPVQEMNSA NQDP+PSSGNGTT+EMQAL Sbjct: 161 REMKNRLSDNVAMPMTVVNPPPVQEMNSAPENQDPAPSSGNGTTMEMQAL 210 >KDO65513.1 hypothetical protein CISIN_1g026575mg [Citrus sinensis] KDO65514.1 hypothetical protein CISIN_1g026575mg [Citrus sinensis] KDO65515.1 hypothetical protein CISIN_1g026575mg [Citrus sinensis] Length = 236 Score = 92.8 bits (229), Expect = 6e-21 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMKN LSDN AMPMTVVNPPPVQEMNSA NQDP+PSSGNGTT+EMQAL Sbjct: 187 REMKNRLSDNVAMPMTVVNPPPVQEMNSAPENQDPAPSSGNGTTMEMQAL 236 >XP_006490124.1 PREDICTED: cell number regulator 6 [Citrus sinensis] XP_006490125.1 PREDICTED: cell number regulator 6 [Citrus sinensis] Length = 236 Score = 92.8 bits (229), Expect = 6e-21 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMKN LSDN AMPMTVVNPPPVQEMNSA NQDP+PSSGNGTT+EMQAL Sbjct: 187 REMKNRLSDNVAMPMTVVNPPPVQEMNSAPENQDPAPSSGNGTTMEMQAL 236 >XP_009613210.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009613211.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_016506189.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016506190.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] Length = 236 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMK+ LSDNAAMPMT+VNPPPVQEMNSA N++ PSS T LEMQAL Sbjct: 187 REMKSRLSDNAAMPMTIVNPPPVQEMNSAIDNRESVPSSSEQTNLEMQAL 236 >XP_007038376.2 PREDICTED: cell number regulator 6 [Theobroma cacao] Length = 233 Score = 75.5 bits (184), Expect = 2e-14 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMK LSDN MPMT+VNPPPVQEMNSA N D +P SG T LEMQAL Sbjct: 184 REMKGRLSDNFVMPMTIVNPPPVQEMNSASENHDSTPPSGTSTNLEMQAL 233 >GAV79129.1 PLAC8 domain-containing protein [Cephalotus follicularis] Length = 235 Score = 75.5 bits (184), Expect = 2e-14 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMKN LSDN +PMT+VNPPPVQEMNSA NQ+ + SGNGT+LEM AL Sbjct: 186 REMKNRLSDNFVVPMTIVNPPPVQEMNSAAENQNCTAPSGNGTSLEMHAL 235 >XP_009788021.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_016463915.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_019236360.1 PREDICTED: cell number regulator 6-like [Nicotiana attenuata] XP_019236361.1 PREDICTED: cell number regulator 6-like [Nicotiana attenuata] OIT23452.1 cell number regulator 6 [Nicotiana attenuata] Length = 239 Score = 75.5 bits (184), Expect = 3e-14 Identities = 38/53 (71%), Positives = 43/53 (81%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMK+ LSDNAAMPMT+VNPPPVQEMN+AR N++ PSS N T LEMQAL Sbjct: 187 REMKSRLSDNAAMPMTIVNPPPVQEMNAARDNRESVPSSANSTEQTNLEMQAL 239 >XP_002510957.1 PREDICTED: cell number regulator 6 [Ricinus communis] EEF51559.1 conserved hypothetical protein [Ricinus communis] Length = 236 Score = 75.1 bits (183), Expect = 3e-14 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMK LSDN MPMT+VNPPPVQEMNSA N+D PSS GT LEMQ L Sbjct: 187 REMKGRLSDNFVMPMTIVNPPPVQEMNSASDNRDSEPSSEKGTNLEMQPL 236 >XP_012090449.1 PREDICTED: cell number regulator 6 [Jatropha curcas] XP_012090450.1 PREDICTED: cell number regulator 6 [Jatropha curcas] KDP22428.1 hypothetical protein JCGZ_26259 [Jatropha curcas] Length = 235 Score = 74.3 bits (181), Expect = 7e-14 Identities = 36/50 (72%), Positives = 38/50 (76%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMK LSDN MPMT+VNPPPVQEMNSA NQ+ PSS GT LEMQ L Sbjct: 186 REMKGRLSDNFVMPMTIVNPPPVQEMNSASENQNSEPSSEKGTNLEMQPL 235 >XP_019245344.1 PREDICTED: cell number regulator 6-like isoform X2 [Nicotiana attenuata] XP_019245352.1 PREDICTED: cell number regulator 6-like isoform X2 [Nicotiana attenuata] Length = 205 Score = 73.6 bits (179), Expect = 8e-14 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMK+ LSDNAAM MT+VNPPPVQEMN+ N++P PSS NG T LEMQAL Sbjct: 153 REMKSRLSDNAAMQMTIVNPPPVQEMNADGDNREPGPSSANGVEQTNLEMQAL 205 >OAY30508.1 hypothetical protein MANES_14G036200 [Manihot esculenta] Length = 235 Score = 73.6 bits (179), Expect = 1e-13 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMK LSDN MPM +VNPPPVQEM+SA N+D PSS GT+LEMQAL Sbjct: 186 REMKGRLSDNFVMPMAIVNPPPVQEMSSASENRDSEPSSDKGTSLEMQAL 235 >XP_019245320.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] XP_019245327.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] XP_019245331.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] XP_019245337.1 PREDICTED: cell number regulator 6-like isoform X1 [Nicotiana attenuata] OIT07892.1 cell number regulator 6 [Nicotiana attenuata] Length = 239 Score = 73.6 bits (179), Expect = 1e-13 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMK+ LSDNAAM MT+VNPPPVQEMN+ N++P PSS NG T LEMQAL Sbjct: 187 REMKSRLSDNAAMQMTIVNPPPVQEMNADGDNREPGPSSANGVEQTNLEMQAL 239 >XP_016462491.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016462492.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] Length = 239 Score = 72.8 bits (177), Expect = 3e-13 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMK+ LSDNAAM MT+VNPPPVQEMN+A N++ PSS NG T LEMQAL Sbjct: 187 REMKSRLSDNAAMQMTIVNPPPVQEMNAAGDNRESGPSSANGGEQTNLEMQAL 239 >XP_009801117.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_009801118.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_009801119.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_009801120.1 PREDICTED: cell number regulator 6-like [Nicotiana sylvestris] XP_016437849.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016437850.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] XP_016437851.1 PREDICTED: cell number regulator 6-like [Nicotiana tabacum] Length = 239 Score = 72.8 bits (177), Expect = 3e-13 Identities = 37/53 (69%), Positives = 41/53 (77%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMKN LSDN AM MT+VNPPPVQEMN+A N++ PSS NG T LEMQAL Sbjct: 187 REMKNRLSDNIAMQMTIVNPPPVQEMNAAGDNRESGPSSANGVEQTNLEMQAL 239 >XP_009602303.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009602304.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009602305.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] XP_009602306.1 PREDICTED: cell number regulator 6-like [Nicotiana tomentosiformis] Length = 239 Score = 72.8 bits (177), Expect = 3e-13 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMK+ LSDNAAM MT+VNPPPVQEMN+A N++ PSS NG T LEMQAL Sbjct: 187 REMKSRLSDNAAMQMTIVNPPPVQEMNAAGDNRESGPSSANGGEQTNLEMQAL 239 >EOY22877.1 Cell number regulator 6 isoform 1 [Theobroma cacao] EOY22878.1 Cell number regulator 6 isoform 1 [Theobroma cacao] Length = 233 Score = 72.4 bits (176), Expect = 3e-13 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNGTTLEMQAL 181 REMK LSDN MPMT+VNPPPVQEMNSA N D + SG T LEMQAL Sbjct: 184 REMKGRLSDNFVMPMTIVNPPPVQEMNSASENHDSTSPSGTSTNLEMQAL 233 >XP_016573333.1 PREDICTED: cell number regulator 6-like [Capsicum annuum] XP_016573334.1 PREDICTED: cell number regulator 6-like [Capsicum annuum] Length = 240 Score = 71.6 bits (174), Expect = 7e-13 Identities = 36/53 (67%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMKN LSDNAAMPMT+VNPPP+QEMN+A N++ PSS + T LEMQAL Sbjct: 188 REMKNRLSDNAAMPMTIVNPPPIQEMNAASDNRESVPSSVDNTEQTNLEMQAL 240 >XP_006358252.1 PREDICTED: cell number regulator 6 [Solanum tuberosum] XP_015169354.1 PREDICTED: cell number regulator 6 [Solanum tuberosum] Length = 239 Score = 70.9 bits (172), Expect = 1e-12 Identities = 36/53 (67%), Positives = 41/53 (77%), Gaps = 3/53 (5%) Frame = -1 Query: 330 REMKNHLSDNAAMPMTVVNPPPVQEMNSARGNQDPSPSSGNG---TTLEMQAL 181 REMK+ LSDN AM MT+VNPPPVQEMN+A N++ PSS NG T LEMQAL Sbjct: 187 REMKSRLSDNVAMQMTIVNPPPVQEMNAAVDNRESGPSSANGVNQTNLEMQAL 239