BLASTX nr result
ID: Phellodendron21_contig00021251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021251 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006430414.1 hypothetical protein CICLE_v10011065mg [Citrus cl... 77 7e-14 KDO57332.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] 77 7e-14 XP_006430415.1 hypothetical protein CICLE_v10011065mg [Citrus cl... 77 7e-14 KDO57328.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] 77 7e-14 KDO57329.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] 77 7e-14 KDO57331.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] 77 7e-14 XP_015387037.1 PREDICTED: auxin response factor 8 isoform X3 [Ci... 77 7e-14 KDO57330.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] 77 7e-14 XP_006481965.1 PREDICTED: auxin response factor 8 isoform X2 [Ci... 77 7e-14 XP_006481964.1 PREDICTED: auxin response factor 8 isoform X1 [Ci... 77 7e-14 XP_006430416.1 hypothetical protein CICLE_v10011065mg [Citrus cl... 77 7e-14 CBI27335.3 unnamed protein product, partial [Vitis vinifera] 67 2e-11 XP_015879676.1 PREDICTED: auxin response factor 8 [Ziziphus jujuba] 69 3e-11 XP_014504678.1 PREDICTED: auxin response factor 8-like isoform X... 68 6e-11 XP_017430293.1 PREDICTED: LOW QUALITY PROTEIN: auxin response fa... 68 6e-11 XP_007141982.1 hypothetical protein PHAVU_008G242400g [Phaseolus... 68 6e-11 BAT81321.1 hypothetical protein VIGAN_03101200 [Vigna angularis ... 68 6e-11 XP_014504677.1 PREDICTED: auxin response factor 8-like isoform X... 68 6e-11 XP_017975077.1 PREDICTED: auxin response factor 8 [Theobroma cac... 68 9e-11 XP_009370590.1 PREDICTED: auxin response factor 8-like isoform X... 67 1e-10 >XP_006430414.1 hypothetical protein CICLE_v10011065mg [Citrus clementina] ESR43654.1 hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 523 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 470 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 511 >KDO57332.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 728 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 675 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 716 >XP_006430415.1 hypothetical protein CICLE_v10011065mg [Citrus clementina] ESR43655.1 hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 731 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 678 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 719 >KDO57328.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 778 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 725 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 766 >KDO57329.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 784 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 731 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 772 >KDO57331.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 799 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 746 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 787 >XP_015387037.1 PREDICTED: auxin response factor 8 isoform X3 [Citrus sinensis] Length = 808 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 755 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 796 >KDO57330.1 hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 811 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 758 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 799 >XP_006481965.1 PREDICTED: auxin response factor 8 isoform X2 [Citrus sinensis] Length = 811 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 758 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 799 >XP_006481964.1 PREDICTED: auxin response factor 8 isoform X1 [Citrus sinensis] Length = 835 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 782 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 823 >XP_006430416.1 hypothetical protein CICLE_v10011065mg [Citrus clementina] ESR43656.1 hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 835 Score = 76.6 bits (187), Expect = 7e-14 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFVSN+WYIKILS EDVQKM EQGVESFS SSGQR NS G Sbjct: 782 WEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRG 823 >CBI27335.3 unnamed protein product, partial [Vitis vinifera] Length = 163 Score = 67.0 bits (162), Expect = 2e-11 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVES-FSQSSGQRTNSSG 127 WEAFV+N+WYIKILS EDVQKM +QG+ES FS +S QR NSSG Sbjct: 103 WEAFVNNVWYIKILSPEDVQKMGKQGIESGFSPNSAQRMNSSG 145 >XP_015879676.1 PREDICTED: auxin response factor 8 [Ziziphus jujuba] Length = 850 Score = 69.3 bits (168), Expect = 3e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WEAFV+N+WYIKILS ED+ KM EQ VESFS ++GQR NSSG Sbjct: 790 WEAFVNNVWYIKILSPEDMHKMGEQAVESFSPNAGQRMNSSG 831 >XP_014504678.1 PREDICTED: auxin response factor 8-like isoform X2 [Vigna radiata var. radiata] Length = 767 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WE+FV+N+WYIKILS ED+QKM EQ VES SSGQR NS+G Sbjct: 708 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTG 749 >XP_017430293.1 PREDICTED: LOW QUALITY PROTEIN: auxin response factor 8-like [Vigna angularis] Length = 841 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WE+FV+N+WYIKILS ED+QKM EQ VES SSGQR NS+G Sbjct: 782 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTG 823 >XP_007141982.1 hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] ESW13976.1 hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] Length = 844 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WE+FV+N+WYIKILS ED+QKM EQ VES SSGQR NS+G Sbjct: 785 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTG 826 >BAT81321.1 hypothetical protein VIGAN_03101200 [Vigna angularis var. angularis] Length = 846 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WE+FV+N+WYIKILS ED+QKM EQ VES SSGQR NS+G Sbjct: 787 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTG 828 >XP_014504677.1 PREDICTED: auxin response factor 8-like isoform X1 [Vigna radiata var. radiata] Length = 847 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WE+FV+N+WYIKILS ED+QKM EQ VES SSGQR NS+G Sbjct: 788 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTG 829 >XP_017975077.1 PREDICTED: auxin response factor 8 [Theobroma cacao] EOY03064.1 Auxin response factor 8-1 [Theobroma cacao] Length = 838 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 W+AFV+N+WYIKILS EDVQKM EQ VE FS + GQR NSSG Sbjct: 779 WDAFVNNVWYIKILSPEDVQKMGEQRVEPFSPTPGQRMNSSG 820 >XP_009370590.1 PREDICTED: auxin response factor 8-like isoform X2 [Pyrus x bretschneideri] Length = 794 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 2 WEAFVSNIWYIKILSREDVQKMAEQGVESFSQSSGQRTNSSG 127 WE+FV+N+WYIKILS EDV KM Q VESFS ++GQR NSSG Sbjct: 735 WESFVNNVWYIKILSPEDVHKMGHQAVESFSPNTGQRLNSSG 776