BLASTX nr result
ID: Phellodendron21_contig00021037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021037 (571 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006475754.1 PREDICTED: acyl-ACP-thioesterase B isoform X1 [Ci... 84 1e-15 NP_001275803.1 acyl-ACP-thioesterase B [Citrus sinensis] XP_0064... 84 2e-15 OMO57990.1 Acyl-ACP thioesterase [Corchorus olitorius] 79 7e-14 XP_007013278.2 PREDICTED: palmitoyl-acyl carrier protein thioest... 77 4e-13 EOY30897.1 Fatty acyl-ACP thioesterases B isoform 2 [Theobroma c... 77 4e-13 EOY30896.1 Fatty acyl-ACP thioesterases B isoform 1 [Theobroma c... 77 4e-13 XP_016718095.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 76 6e-13 XP_016720630.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 76 6e-13 XP_012448973.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 76 6e-13 XP_017630747.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 76 6e-13 AOR17397.1 palmitoyl-acyl carrier protein thioesterase, partial ... 76 6e-13 AOR17396.1 palmitoyl-acyl carrier protein thioesterase, partial ... 76 6e-13 GAV92051.1 Acyl-ACP_TE domain-containing protein/Acyl-thio_N dom... 76 8e-13 XP_010688133.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 76 8e-13 AHI86053.1 plastid acyl-ACP thioesterase [Vernicia fordii] 75 1e-12 AIX97815.1 fatty acyl-ACP thioesterase B [Prunus sibirica] 75 2e-12 XP_008242683.1 PREDICTED: palmitoyl-acyl carrier protein thioest... 75 2e-12 XP_007202158.1 hypothetical protein PRUPE_ppa006328mg [Prunus pe... 75 2e-12 OAY21900.1 hypothetical protein MANES_S047300 [Manihot esculenta] 75 2e-12 KNA22441.1 hypothetical protein SOVF_034010 [Spinacia oleracea] 75 2e-12 >XP_006475754.1 PREDICTED: acyl-ACP-thioesterase B isoform X1 [Citrus sinensis] KDO80422.1 hypothetical protein CISIN_1g014795mg [Citrus sinensis] Length = 395 Score = 83.6 bits (205), Expect = 1e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAEST 438 LGSVECQHLLRLEEGAE++RARTEWRPK A NFGN+G IPAEST Sbjct: 352 LGSVECQHLLRLEEGAEVLRARTEWRPKDAHNFGNVGPIPAEST 395 >NP_001275803.1 acyl-ACP-thioesterase B [Citrus sinensis] XP_006451052.1 hypothetical protein CICLE_v10008435mg [Citrus clementina] AEX99667.1 acyl-ACP-thioesterase B [Citrus sinensis] ESR64292.1 hypothetical protein CICLE_v10008435mg [Citrus clementina] KDO80423.1 hypothetical protein CISIN_1g014795mg [Citrus sinensis] KDO80424.1 hypothetical protein CISIN_1g014795mg [Citrus sinensis] Length = 418 Score = 83.6 bits (205), Expect = 2e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAEST 438 LGSVECQHLLRLEEGAE++RARTEWRPK A NFGN+G IPAEST Sbjct: 375 LGSVECQHLLRLEEGAEVLRARTEWRPKDAHNFGNVGPIPAEST 418 >OMO57990.1 Acyl-ACP thioesterase [Corchorus olitorius] Length = 420 Score = 79.0 bits (193), Expect = 7e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 LG VECQHLLRLEEGAEIVR RTEWRPK A++FG++GQIPAES Sbjct: 377 LGEVECQHLLRLEEGAEIVRGRTEWRPKHAKSFGDVGQIPAES 419 >XP_007013278.2 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Theobroma cacao] Length = 420 Score = 76.6 bits (187), Expect = 4e-13 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G +ECQHLLRLE+G+EIVR RTEWRPK A++FGN+GQ+PAES Sbjct: 378 GEIECQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 419 >EOY30897.1 Fatty acyl-ACP thioesterases B isoform 2 [Theobroma cacao] Length = 420 Score = 76.6 bits (187), Expect = 4e-13 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G +ECQHLLRLE+G+EIVR RTEWRPK A++FGN+GQ+PAES Sbjct: 378 GEIECQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 419 >EOY30896.1 Fatty acyl-ACP thioesterases B isoform 1 [Theobroma cacao] Length = 426 Score = 76.6 bits (187), Expect = 4e-13 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G +ECQHLLRLE+G+EIVR RTEWRPK A++FGN+GQ+PAES Sbjct: 384 GEIECQHLLRLEDGSEIVRGRTEWRPKYAKSFGNVGQLPAES 425 >XP_016718095.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Gossypium hirsutum] Length = 420 Score = 76.3 bits (186), Expect = 6e-13 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 +G +ECQHLL+LEEG+EIVR RT+WRPK A++FGN+GQIPAES Sbjct: 377 VGEIECQHLLQLEEGSEIVRGRTQWRPKYAKSFGNVGQIPAES 419 >XP_016720630.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Gossypium hirsutum] Length = 420 Score = 76.3 bits (186), Expect = 6e-13 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 +G +ECQHLL+LEEG+EIVR RT+WRPK A++FGN+GQIPAES Sbjct: 377 VGEIECQHLLQLEEGSEIVRGRTQWRPKYAKSFGNVGQIPAES 419 >XP_012448973.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Gossypium raimondii] KJB07169.1 hypothetical protein B456_001G003300 [Gossypium raimondii] KJB07170.1 hypothetical protein B456_001G003300 [Gossypium raimondii] Length = 420 Score = 76.3 bits (186), Expect = 6e-13 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 +G +ECQHLL+LEEG+EIVR RT+WRPK A++FGN+GQIPAES Sbjct: 377 VGEIECQHLLQLEEGSEIVRGRTQWRPKYAKSFGNVGQIPAES 419 >XP_017630747.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Gossypium arboreum] KHG13756.1 Myristoyl-acyl carrier thioesterase, chloroplastic [Gossypium arboreum] Length = 420 Score = 76.3 bits (186), Expect = 6e-13 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -3 Query: 569 LGSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 +G +ECQHLL+LEEG+EIVR RT+WRPK A++FGN+GQIPAES Sbjct: 377 VGEIECQHLLQLEEGSEIVRGRTQWRPKYAKSFGNVGQIPAES 419 >AOR17397.1 palmitoyl-acyl carrier protein thioesterase, partial [Mangifera indica] Length = 425 Score = 76.3 bits (186), Expect = 6e-13 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G VECQH+L+LE+GAEIVR RTEWRPK A NFGN+G++PAES Sbjct: 383 GRVECQHMLQLEDGAEIVRGRTEWRPKYANNFGNVGEVPAES 424 >AOR17396.1 palmitoyl-acyl carrier protein thioesterase, partial [Mangifera indica] Length = 425 Score = 76.3 bits (186), Expect = 6e-13 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G VECQH+L+LE+GAEIVR RTEWRPK A NFGN+G++PAES Sbjct: 383 GRVECQHMLQLEDGAEIVRGRTEWRPKYANNFGNVGEVPAES 424 >GAV92051.1 Acyl-ACP_TE domain-containing protein/Acyl-thio_N domain-containing protein [Cephalotus follicularis] Length = 421 Score = 75.9 bits (185), Expect = 8e-13 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G ECQHLLRLE+GAEIVR RTEWRPK A NFG +GQIPAES Sbjct: 379 GRAECQHLLRLEDGAEIVRGRTEWRPKYANNFGTLGQIPAES 420 >XP_010688133.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Beta vulgaris subsp. vulgaris] XP_010688134.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Beta vulgaris subsp. vulgaris] XP_019106990.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Beta vulgaris subsp. vulgaris] KMT02998.1 hypothetical protein BVRB_8g195640 [Beta vulgaris subsp. vulgaris] Length = 421 Score = 75.9 bits (185), Expect = 8e-13 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G+VECQHLLRLE+GAE++R RTEWRPK A+NFG +GQ+PAES Sbjct: 379 GNVECQHLLRLEDGAEVMRGRTEWRPKHAKNFGKLGQVPAES 420 >AHI86053.1 plastid acyl-ACP thioesterase [Vernicia fordii] Length = 418 Score = 75.5 bits (184), Expect = 1e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G +ECQHLLRLEEGAEIVR RTEWRPK NFG +GQIPAES Sbjct: 376 GEIECQHLLRLEEGAEIVRGRTEWRPKYTSNFGIMGQIPAES 417 >AIX97815.1 fatty acyl-ACP thioesterase B [Prunus sibirica] Length = 417 Score = 75.1 bits (183), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G VECQHLLRLEEGAEIVR RTEWRPK A N G +GQ+PAES Sbjct: 375 GGVECQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >XP_008242683.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] XP_008242684.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] XP_016651836.1 PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Prunus mume] Length = 417 Score = 75.1 bits (183), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G VECQHLLRLEEGAEIVR RTEWRPK A N G +GQ+PAES Sbjct: 375 GGVECQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >XP_007202158.1 hypothetical protein PRUPE_ppa006328mg [Prunus persica] ONH98189.1 hypothetical protein PRUPE_7G234600 [Prunus persica] ONH98190.1 hypothetical protein PRUPE_7G234600 [Prunus persica] ONH98191.1 hypothetical protein PRUPE_7G234600 [Prunus persica] Length = 417 Score = 75.1 bits (183), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G VECQHLLRLEEGAEIVR RTEWRPK A N G +GQ+PAES Sbjct: 375 GGVECQHLLRLEEGAEIVRGRTEWRPKYANNLGIVGQLPAES 416 >OAY21900.1 hypothetical protein MANES_S047300 [Manihot esculenta] Length = 418 Score = 75.1 bits (183), Expect = 2e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G +ECQHLLRLE+GAEIVR RTEWRPK A NFG +GQ+PAES Sbjct: 376 GEIECQHLLRLEDGAEIVRGRTEWRPKYASNFGIMGQLPAES 417 >KNA22441.1 hypothetical protein SOVF_034010 [Spinacia oleracea] Length = 421 Score = 74.7 bits (182), Expect = 2e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -3 Query: 566 GSVECQHLLRLEEGAEIVRARTEWRPKVAQNFGNIGQIPAES 441 G+VECQHLLRLE+GAE+VR RTEWRPK A+NFG +GQ+P ES Sbjct: 379 GNVECQHLLRLEDGAEVVRGRTEWRPKHAKNFGMLGQVPVES 420