BLASTX nr result
ID: Phellodendron21_contig00021013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00021013 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006477189.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 54 1e-07 XP_006440310.1 hypothetical protein CICLE_v10019519mg [Citrus cl... 54 1e-07 KDO61440.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] 54 1e-07 KDO61441.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] 54 1e-07 KDO61442.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] 54 1e-07 KDO61439.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] 54 1e-07 KDO61438.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] 54 1e-07 EOY24335.1 Class II aminoacyl-tRNA and biotin synthetases superf... 57 1e-07 XP_018847042.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 8e-07 XP_012069983.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 8e-07 OAY60031.1 hypothetical protein MANES_01G080800 [Manihot esculenta] 50 9e-07 XP_018847041.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 9e-07 XP_011026436.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 2e-06 XP_002309798.2 hypothetical protein POPTR_0007s01840g [Populus t... 50 2e-06 XP_011037109.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 2e-06 XP_006372859.1 asparaginyl-tRNA synthetase family protein [Popul... 50 2e-06 XP_019230713.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 2e-06 XP_016489711.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 2e-06 XP_015070466.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 2e-06 XP_006351539.1 PREDICTED: asparagine--tRNA ligase, chloroplastic... 50 2e-06 >XP_006477189.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial [Citrus sinensis] Length = 563 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 432 DLQSEHERYLTEEAFGGCPVIVSDYPK 458 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 458 KEIKAFYMRQNDD 470 >XP_006440310.1 hypothetical protein CICLE_v10019519mg [Citrus clementina] ESR53550.1 hypothetical protein CICLE_v10019519mg [Citrus clementina] Length = 563 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 432 DLQSEHERYLTEEAFGGCPVIVSDYPK 458 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 458 KEIKAFYMRQNDD 470 >KDO61440.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] Length = 491 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 360 DLQSEHERYLTEEAFGGCPVIVSDYPK 386 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 386 KEIKAFYMRQNDD 398 >KDO61441.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] Length = 487 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 356 DLQSEHERYLTEEAFGGCPVIVSDYPK 382 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 382 KEIKAFYMRQNDD 394 >KDO61442.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] Length = 464 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 356 DLQSEHERYLTEEAFGGCPVIVSDYPK 382 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 382 KEIKAFYMRQNDD 394 >KDO61439.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] Length = 461 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 330 DLQSEHERYLTEEAFGGCPVIVSDYPK 356 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 356 KEIKAFYMRQNDD 368 >KDO61438.1 hypothetical protein CISIN_1g011197mg [Citrus sinensis] Length = 460 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE YLTEE FGGC VIVSDYPK Sbjct: 329 DLQSEHERYLTEEAFGGCPVIVSDYPK 355 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 355 KEIKAFYMRQNDD 367 >EOY24335.1 Class II aminoacyl-tRNA and biotin synthetases superfamily protein isoform 2 [Theobroma cacao] Length = 401 Score = 56.6 bits (135), Expect = 1e-07 Identities = 34/79 (43%), Positives = 37/79 (46%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPKARNPLPFSVSLLEECGRLYDGSFYHVWN*YCTV 181 DLQSEHE Y+TEE F GC VI+ DYPKA N W Sbjct: 356 DLQSEHERYITEEAFNGCPVIIRDYPKACN-----------------------W------ 386 Query: 182 S*CKTYKRSRHSICGRMMM 238 RSRHSICG+MMM Sbjct: 387 -------RSRHSICGKMMM 398 >XP_018847042.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial isoform X2 [Juglans regia] Length = 586 Score = 50.4 bits (119), Expect(2) = 8e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 455 DLQSEHERYITEEAFGGCPVIIRDYPK 481 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 481 KEIKAFYMRQNDD 493 >XP_012069983.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial [Jatropha curcas] KDP39873.1 hypothetical protein JCGZ_03404 [Jatropha curcas] Length = 579 Score = 50.4 bits (119), Expect(2) = 8e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 448 DLQSEHERYITEEAFGGCPVIIRDYPK 474 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 474 KEIKAFYMRQNDD 486 >OAY60031.1 hypothetical protein MANES_01G080800 [Manihot esculenta] Length = 577 Score = 50.4 bits (119), Expect(2) = 9e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 446 DLQSEHERYITEEAFGGCPVIIRDYPK 472 Score = 29.6 bits (65), Expect(2) = 9e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 472 KEIKAFYMRQNDD 484 >XP_018847041.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial isoform X1 [Juglans regia] Length = 556 Score = 50.4 bits (119), Expect(2) = 9e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 455 DLQSEHERYITEEAFGGCPVIIRDYPK 481 Score = 29.6 bits (65), Expect(2) = 9e-07 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 +EIKAFYMRQNDD Sbjct: 481 KEIKAFYMRQNDD 493 >XP_011026436.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] XP_011026438.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] XP_011026439.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] XP_011026440.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] XP_011026441.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] XP_011026442.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] Length = 578 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 447 DLQSEHERYITEEAFGGCPVIIRDYPK 473 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 473 KDIKAFYMRQNDD 485 >XP_002309798.2 hypothetical protein POPTR_0007s01840g [Populus trichocarpa] EEE90248.2 hypothetical protein POPTR_0007s01840g [Populus trichocarpa] Length = 578 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 447 DLQSEHERYITEEAFGGCPVIIRDYPK 473 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 473 KDIKAFYMRQNDD 485 >XP_011037109.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Populus euphratica] Length = 574 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 443 DLQSEHERYITEEVFGGCPVIIRDYPK 469 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 469 KDIKAFYMRQNDD 481 >XP_006372859.1 asparaginyl-tRNA synthetase family protein [Populus trichocarpa] ERP50656.1 asparaginyl-tRNA synthetase family protein [Populus trichocarpa] Length = 574 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 443 DLQSEHERYITEEVFGGCPVIIRDYPK 469 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 469 KDIKAFYMRQNDD 481 >XP_019230713.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial [Nicotiana attenuata] OIT29237.1 asparagine--trna ligase, chloroplasticmitochondrial [Nicotiana attenuata] Length = 572 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 441 DLQSEHERYITEEAFGGCPVIIRDYPK 467 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 467 KDIKAFYMRQNDD 479 >XP_016489711.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial-like [Nicotiana tabacum] Length = 572 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 441 DLQSEHERYITEEAFGGCPVIIRDYPK 467 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 467 KDIKAFYMRQNDD 479 >XP_015070466.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial [Solanum pennellii] Length = 571 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 440 DLQSEHERYITEEAFGGCPVIIRDYPK 466 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 466 KDIKAFYMRQNDD 478 >XP_006351539.1 PREDICTED: asparagine--tRNA ligase, chloroplastic/mitochondrial [Solanum tuberosum] Length = 571 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 2 DLQSEHESYLTEETFGGCLVIVSDYPK 82 DLQSEHE Y+TEE FGGC VI+ DYPK Sbjct: 440 DLQSEHERYITEEAFGGCPVIIRDYPK 466 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 199 QEIKAFYMRQNDD 237 ++IKAFYMRQNDD Sbjct: 466 KDIKAFYMRQNDD 478