BLASTX nr result
ID: Phellodendron21_contig00020749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020749 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO86202.1 hypothetical protein CISIN_1g009352mg [Citrus sinensi... 62 1e-08 XP_006445014.1 hypothetical protein CICLE_v10019660mg [Citrus cl... 62 1e-08 XP_008458216.1 PREDICTED: origin of replication complex subunit ... 60 5e-08 XP_004138588.1 PREDICTED: origin of replication complex subunit ... 60 5e-08 XP_011092594.1 PREDICTED: origin recognition complex subunit 5 [... 60 5e-08 XP_014497204.1 PREDICTED: origin of replication complex subunit ... 59 1e-07 XP_007139825.1 hypothetical protein PHAVU_008G061800g [Phaseolus... 59 1e-07 GAU30790.1 hypothetical protein TSUD_355160 [Trifolium subterran... 59 1e-07 KYP64215.1 Origin recognition complex subunit 5 [Cajanus cajan] 59 1e-07 CBI15609.3 unnamed protein product, partial [Vitis vinifera] 58 3e-07 XP_008342080.2 PREDICTED: LOW QUALITY PROTEIN: origin of replica... 58 3e-07 XP_009367815.1 PREDICTED: origin of replication complex subunit ... 58 3e-07 XP_010663715.1 PREDICTED: origin of replication complex subunit ... 58 3e-07 XP_004306771.1 PREDICTED: origin of replication complex subunit ... 58 3e-07 KHG29409.1 Origin recognition complex subunit 5 [Gossypium arbor... 57 3e-07 KRH40442.1 hypothetical protein GLYMA_09G258700 [Glycine max] 57 3e-07 XP_016694912.1 PREDICTED: origin of replication complex subunit ... 57 3e-07 XP_007051774.2 PREDICTED: origin of replication complex subunit ... 57 3e-07 XP_017628332.1 PREDICTED: origin of replication complex subunit ... 57 3e-07 XP_016667206.1 PREDICTED: origin of replication complex subunit ... 57 3e-07 >KDO86202.1 hypothetical protein CISIN_1g009352mg [Citrus sinensis] KDO86203.1 hypothetical protein CISIN_1g009352mg [Citrus sinensis] Length = 535 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYRSTLSEDLA+KVARS+KFPLSKYLYRR Sbjct: 505 STRYRSTLSEDLAMKVARSIKFPLSKYLYRR 535 >XP_006445014.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] XP_006445015.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] XP_006445016.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] XP_006445017.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] XP_006491130.1 PREDICTED: origin of replication complex subunit 5 [Citrus sinensis] XP_006491131.1 PREDICTED: origin of replication complex subunit 5 [Citrus sinensis] XP_006491132.1 PREDICTED: origin of replication complex subunit 5 [Citrus sinensis] ESR58254.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] ESR58255.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] ESR58256.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] ESR58257.1 hypothetical protein CICLE_v10019660mg [Citrus clementina] Length = 535 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYRSTLSEDLA+KVARS+KFPLSKYLYRR Sbjct: 505 STRYRSTLSEDLAIKVARSIKFPLSKYLYRR 535 >XP_008458216.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_008458217.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_008458218.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_008458219.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_008458220.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_008458221.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_008458222.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] XP_016902307.1 PREDICTED: origin of replication complex subunit 5 [Cucumis melo] Length = 536 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYRST+SED+ALKVARS+KFPLSKY+YRR Sbjct: 506 STRYRSTVSEDMALKVARSIKFPLSKYMYRR 536 >XP_004138588.1 PREDICTED: origin of replication complex subunit 5 [Cucumis sativus] XP_011656341.1 PREDICTED: origin of replication complex subunit 5 [Cucumis sativus] KGN45666.1 hypothetical protein Csa_6G004570 [Cucumis sativus] Length = 536 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYRST+SED+ALKVARS+KFPLSKY+YRR Sbjct: 506 STRYRSTVSEDMALKVARSIKFPLSKYMYRR 536 >XP_011092594.1 PREDICTED: origin recognition complex subunit 5 [Sesamum indicum] XP_011092603.1 PREDICTED: origin recognition complex subunit 5 [Sesamum indicum] Length = 542 Score = 59.7 bits (143), Expect = 5e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYRST+SED+ALK+ARS+KFPLSKYLYRR Sbjct: 512 STRYRSTISEDMALKIARSLKFPLSKYLYRR 542 >XP_014497204.1 PREDICTED: origin of replication complex subunit 5 [Vigna radiata var. radiata] XP_014497205.1 PREDICTED: origin of replication complex subunit 5 [Vigna radiata var. radiata] Length = 539 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SEDLALKVARS+KFPLSKYLYR Sbjct: 509 STRYRSTISEDLALKVARSLKFPLSKYLYR 538 >XP_007139825.1 hypothetical protein PHAVU_008G061800g [Phaseolus vulgaris] XP_007139826.1 hypothetical protein PHAVU_008G061800g [Phaseolus vulgaris] XP_007139827.1 hypothetical protein PHAVU_008G061800g [Phaseolus vulgaris] ESW11819.1 hypothetical protein PHAVU_008G061800g [Phaseolus vulgaris] ESW11820.1 hypothetical protein PHAVU_008G061800g [Phaseolus vulgaris] ESW11821.1 hypothetical protein PHAVU_008G061800g [Phaseolus vulgaris] Length = 539 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SEDLALKVARS+KFPLSKYLYR Sbjct: 509 STRYRSTISEDLALKVARSLKFPLSKYLYR 538 >GAU30790.1 hypothetical protein TSUD_355160 [Trifolium subterraneum] Length = 542 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SEDLALKVARS+KFPLSKYLYR Sbjct: 512 STRYRSTISEDLALKVARSLKFPLSKYLYR 541 >KYP64215.1 Origin recognition complex subunit 5 [Cajanus cajan] Length = 542 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SEDLALKVARS+KFPLSKYLYR Sbjct: 512 STRYRSTISEDLALKVARSLKFPLSKYLYR 541 >CBI15609.3 unnamed protein product, partial [Vitis vinifera] Length = 524 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYR+T+SEDLALKVARS+KFPLSKYLYR Sbjct: 494 STRYRATISEDLALKVARSLKFPLSKYLYR 523 >XP_008342080.2 PREDICTED: LOW QUALITY PROTEIN: origin of replication complex subunit 5-like [Malus domestica] Length = 536 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SED+ALKVARS+KFPLSKY+YR Sbjct: 507 STRYRSTVSEDMALKVARSIKFPLSKYIYR 536 >XP_009367815.1 PREDICTED: origin of replication complex subunit 5 [Pyrus x bretschneideri] Length = 536 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SED+ALKVARS+KFPLSKY+YR Sbjct: 507 STRYRSTVSEDMALKVARSIKFPLSKYIYR 536 >XP_010663715.1 PREDICTED: origin of replication complex subunit 5 [Vitis vinifera] Length = 540 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYR+T+SEDLALKVARS+KFPLSKYLYR Sbjct: 510 STRYRATISEDLALKVARSLKFPLSKYLYR 539 >XP_004306771.1 PREDICTED: origin of replication complex subunit 5-like [Fragaria vesca subsp. vesca] XP_011469006.1 PREDICTED: origin of replication complex subunit 5-like [Fragaria vesca subsp. vesca] Length = 582 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYRST++ED+AL+VARS+KFPLSKYLYRR Sbjct: 552 STRYRSTVTEDMALQVARSIKFPLSKYLYRR 582 >KHG29409.1 Origin recognition complex subunit 5 [Gossypium arboreum] Length = 505 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYR+ +SEDLALKVARS+KFPLSKYLYRR Sbjct: 475 STRYRTAVSEDLALKVARSLKFPLSKYLYRR 505 >KRH40442.1 hypothetical protein GLYMA_09G258700 [Glycine max] Length = 510 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYR 271 STRYRST+SEDLALKVARS++FPLSKYLYR Sbjct: 480 STRYRSTISEDLALKVARSLEFPLSKYLYR 509 >XP_016694912.1 PREDICTED: origin of replication complex subunit 5-like [Gossypium hirsutum] Length = 532 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYR+ +SEDLALKVARS+KFPLSKYLYRR Sbjct: 502 STRYRTAVSEDLALKVARSLKFPLSKYLYRR 532 >XP_007051774.2 PREDICTED: origin of replication complex subunit 5 [Theobroma cacao] Length = 533 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYR+ +SEDLALKVARS+KFPLSKYLYRR Sbjct: 503 STRYRTAVSEDLALKVARSLKFPLSKYLYRR 533 >XP_017628332.1 PREDICTED: origin of replication complex subunit 5 [Gossypium arboreum] Length = 533 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYR+ +SEDLALKVARS+KFPLSKYLYRR Sbjct: 503 STRYRTAVSEDLALKVARSLKFPLSKYLYRR 533 >XP_016667206.1 PREDICTED: origin of replication complex subunit 5-like [Gossypium hirsutum] Length = 533 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 360 STRYRSTLSEDLALKVARSVKFPLSKYLYRR 268 STRYR+ +SEDLALKVARS+KFPLSKYLYRR Sbjct: 503 STRYRTAVSEDLALKVARSLKFPLSKYLYRR 533