BLASTX nr result
ID: Phellodendron21_contig00020713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020713 (617 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006440822.1 hypothetical protein CICLE_v10021100mg [Citrus cl... 112 2e-26 KDO65645.1 hypothetical protein CISIN_1g036178mg [Citrus sinensis] 112 3e-26 XP_006485709.1 PREDICTED: dof zinc finger protein DOF5.4-like [C... 112 3e-26 AJG01743.1 Dof25, partial [Cajanus cajan] 102 6e-24 GAV77351.1 zf-Dof domain-containing protein [Cephalotus follicul... 105 6e-24 DAA64932.1 TPA_inf: dof protein [Cajanus cajan] KYP56727.1 Dof z... 102 2e-23 XP_013458026.1 Dof domain zinc finger protein [Medicago truncatu... 102 9e-23 XP_004508651.1 PREDICTED: dof zinc finger protein DOF5.4 [Cicer ... 102 1e-22 KVH99299.1 Zinc finger, Dof-type [Cynara cardunculus var. scolymus] 100 3e-22 XP_014630893.1 PREDICTED: dof zinc finger protein DOF5.4-like [G... 100 6e-22 CDY40813.1 BnaC02g41820D [Brassica napus] 100 7e-22 KRH54755.1 hypothetical protein GLYMA_06G206400 [Glycine max] 100 7e-22 XP_017430102.1 PREDICTED: dof zinc finger protein DOF5.4 isoform... 100 7e-22 XP_014506030.1 PREDICTED: dof zinc finger protein DOF5.4-like [V... 100 7e-22 XP_009130136.1 PREDICTED: dof zinc finger protein DOF5.4-like [B... 100 7e-22 CDY42836.1 BnaAnng06610D [Brassica napus] 100 7e-22 XP_007155202.1 hypothetical protein PHAVU_003G182100g [Phaseolus... 100 7e-22 XP_019578122.1 PREDICTED: dof zinc finger protein DOF5.4-like [R... 100 9e-22 XP_007138384.1 hypothetical protein PHAVU_009G204000g [Phaseolus... 100 9e-22 XP_017420824.1 PREDICTED: dof zinc finger protein DOF5.4-like [V... 100 9e-22 >XP_006440822.1 hypothetical protein CICLE_v10021100mg [Citrus clementina] ESR54062.1 hypothetical protein CICLE_v10021100mg [Citrus clementina] Length = 329 Score = 112 bits (280), Expect = 2e-26 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKR++KPKPNSE S Sbjct: 48 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSSKPKPNSESS 98 >KDO65645.1 hypothetical protein CISIN_1g036178mg [Citrus sinensis] Length = 330 Score = 112 bits (280), Expect = 3e-26 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKR++KPKPNSE S Sbjct: 48 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSSKPKPNSESS 98 >XP_006485709.1 PREDICTED: dof zinc finger protein DOF5.4-like [Citrus sinensis] Length = 334 Score = 112 bits (280), Expect = 3e-26 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKR++KPKPNSE S Sbjct: 48 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSSKPKPNSESS 98 >AJG01743.1 Dof25, partial [Cajanus cajan] Length = 186 Score = 102 bits (255), Expect = 6e-24 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEP 191 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR++KP +S P Sbjct: 25 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPPSDSAP 74 >GAV77351.1 zf-Dof domain-containing protein [Cephalotus follicularis] Length = 303 Score = 105 bits (262), Expect = 6e-24 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCK+CRRYWTKGGVLRNVPVGGGCRKTKR AKPKP S S Sbjct: 47 YNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRAAKPKPPSSSS 97 >DAA64932.1 TPA_inf: dof protein [Cajanus cajan] KYP56727.1 Dof zinc finger protein DOF5.4 [Cajanus cajan] Length = 244 Score = 102 bits (255), Expect = 2e-23 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEP 191 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR++KP +S P Sbjct: 46 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPPSDSAP 95 >XP_013458026.1 Dof domain zinc finger protein [Medicago truncatula] KEH32057.1 Dof domain zinc finger protein [Medicago truncatula] Length = 320 Score = 102 bits (255), Expect = 9e-23 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNS 197 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR++KPK +S Sbjct: 55 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPKKSS 102 >XP_004508651.1 PREDICTED: dof zinc finger protein DOF5.4 [Cicer arietinum] Length = 307 Score = 102 bits (254), Expect = 1e-22 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KPK +S S Sbjct: 51 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPKNSSSSS 101 >KVH99299.1 Zinc finger, Dof-type [Cynara cardunculus var. scolymus] Length = 297 Score = 100 bits (250), Expect = 3e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKR +KPK N+ S Sbjct: 57 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKR-SKPKSNNNRS 106 >XP_014630893.1 PREDICTED: dof zinc finger protein DOF5.4-like [Glycine max] KRH56758.1 hypothetical protein GLYMA_05G018100 [Glycine max] Length = 292 Score = 100 bits (248), Expect = 6e-22 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNS 197 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR++KP S Sbjct: 44 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSSKPTKTS 91 >CDY40813.1 BnaC02g41820D [Brassica napus] Length = 283 Score = 99.8 bits (247), Expect = 7e-22 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK KR +KPK + PS Sbjct: 59 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKR-SKPKQDQPPS 108 >KRH54755.1 hypothetical protein GLYMA_06G206400 [Glycine max] Length = 303 Score = 100 bits (248), Expect = 7e-22 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPK 206 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KPK Sbjct: 47 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPK 91 >XP_017430102.1 PREDICTED: dof zinc finger protein DOF5.4 isoform X1 [Vigna angularis] XP_017430190.1 PREDICTED: dof zinc finger protein DOF5.4 isoform X2 [Vigna angularis] BAT76493.1 hypothetical protein VIGAN_01450700 [Vigna angularis var. angularis] Length = 285 Score = 99.8 bits (247), Expect = 7e-22 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSE 194 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KP S+ Sbjct: 56 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPAKTSD 104 >XP_014506030.1 PREDICTED: dof zinc finger protein DOF5.4-like [Vigna radiata var. radiata] Length = 286 Score = 99.8 bits (247), Expect = 7e-22 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSE 194 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KP S+ Sbjct: 57 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPAKTSD 105 >XP_009130136.1 PREDICTED: dof zinc finger protein DOF5.4-like [Brassica rapa] Length = 286 Score = 99.8 bits (247), Expect = 7e-22 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK KR +KPK + PS Sbjct: 59 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKR-SKPKQDQPPS 108 >CDY42836.1 BnaAnng06610D [Brassica napus] Length = 286 Score = 99.8 bits (247), Expect = 7e-22 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK KR +KPK + PS Sbjct: 59 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKR-SKPKQDQPPS 108 >XP_007155202.1 hypothetical protein PHAVU_003G182100g [Phaseolus vulgaris] ESW27196.1 hypothetical protein PHAVU_003G182100g [Phaseolus vulgaris] Length = 287 Score = 99.8 bits (247), Expect = 7e-22 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPKPNSE 194 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KP S+ Sbjct: 58 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPAKTSD 106 >XP_019578122.1 PREDICTED: dof zinc finger protein DOF5.4-like [Rhinolophus sinicus] Length = 297 Score = 99.8 bits (247), Expect = 9e-22 Identities = 44/52 (84%), Positives = 47/52 (90%), Gaps = 1/52 (1%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRN-AKPKPNSEPS 188 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK KR+ +K P+S PS Sbjct: 66 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSKSKQPPSSSPS 117 >XP_007138384.1 hypothetical protein PHAVU_009G204000g [Phaseolus vulgaris] ESW10378.1 hypothetical protein PHAVU_009G204000g [Phaseolus vulgaris] Length = 318 Score = 100 bits (248), Expect = 9e-22 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPK 206 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KPK Sbjct: 40 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPK 84 >XP_017420824.1 PREDICTED: dof zinc finger protein DOF5.4-like [Vigna angularis] KOM40104.1 hypothetical protein LR48_Vigan04g030200 [Vigna angularis] BAT79822.1 hypothetical protein VIGAN_02276200 [Vigna angularis var. angularis] Length = 320 Score = 100 bits (248), Expect = 9e-22 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -2 Query: 340 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRNAKPK 206 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK+KR+ KPK Sbjct: 40 YNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSNKPK 84