BLASTX nr result
ID: Phellodendron21_contig00020653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020653 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006430518.1 hypothetical protein CICLE_v10011642mg [Citrus cl... 64 6e-10 XP_006430519.1 hypothetical protein CICLE_v10011642mg [Citrus cl... 64 6e-10 KDO53649.1 hypothetical protein CISIN_1g011488mg [Citrus sinensis] 64 6e-10 XP_006482051.1 PREDICTED: G2/mitotic-specific cyclin S13-7-like ... 64 6e-10 XP_002283152.1 PREDICTED: G2/mitotic-specific cyclin S13-7 [Viti... 62 6e-09 BAA20413.1 B-type cyclin, partial [Catharanthus roseus] 57 6e-08 BAA20411.1 B-type cyclin [Catharanthus roseus] 57 2e-07 XP_011079084.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Ses... 56 4e-07 CAN73346.1 hypothetical protein VITISV_037918 [Vitis vinifera] 55 2e-06 CBI25451.3 unnamed protein product, partial [Vitis vinifera] 55 2e-06 XP_010658250.2 PREDICTED: G2/mitotic-specific cyclin S13-7 isofo... 55 2e-06 XP_002273378.2 PREDICTED: G2/mitotic-specific cyclin S13-7 isofo... 55 2e-06 XP_010271918.1 PREDICTED: G2/mitotic-specific cyclin S13-7-like ... 54 3e-06 XP_012828105.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Ery... 54 4e-06 CDP06215.1 unnamed protein product [Coffea canephora] 54 4e-06 XP_015159582.1 PREDICTED: G2/mitotic-specific cyclin S13-7-like ... 53 7e-06 XP_011091938.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Ses... 53 7e-06 GAV92562.1 Cyclin_N domain-containing protein/Cyclin_C domain-co... 53 7e-06 OMO53900.1 hypothetical protein CCACVL1_28253 [Corchorus capsula... 53 7e-06 XP_011070091.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Ses... 52 1e-05 >XP_006430518.1 hypothetical protein CICLE_v10011642mg [Citrus clementina] ESR43758.1 hypothetical protein CICLE_v10011642mg [Citrus clementina] Length = 471 Score = 64.3 bits (155), Expect = 6e-10 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFCXXXXXXXXXXXXXXXXXTCNNVN 206 LNDIGNLVTV GVDGKPQPQISRPITRSFC C N+N Sbjct: 38 LNDIGNLVTVNGVDGKPQPQISRPITRSFCAQLLANAQAAAENNKKQACVNMN 90 >XP_006430519.1 hypothetical protein CICLE_v10011642mg [Citrus clementina] ESR43759.1 hypothetical protein CICLE_v10011642mg [Citrus clementina] Length = 474 Score = 64.3 bits (155), Expect = 6e-10 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFCXXXXXXXXXXXXXXXXXTCNNVN 206 LNDIGNLVTV GVDGKPQPQISRPITRSFC C N+N Sbjct: 41 LNDIGNLVTVNGVDGKPQPQISRPITRSFCAQLLANAQAAAENNKKQACVNMN 93 >KDO53649.1 hypothetical protein CISIN_1g011488mg [Citrus sinensis] Length = 484 Score = 64.3 bits (155), Expect = 6e-10 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFCXXXXXXXXXXXXXXXXXTCNNVN 206 LNDIGNLVTV GVDGKPQPQISRPITRSFC C N+N Sbjct: 41 LNDIGNLVTVNGVDGKPQPQISRPITRSFCAQLLANAQAAAENNKKQACVNMN 93 >XP_006482051.1 PREDICTED: G2/mitotic-specific cyclin S13-7-like [Citrus sinensis] Length = 484 Score = 64.3 bits (155), Expect = 6e-10 Identities = 32/53 (60%), Positives = 33/53 (62%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFCXXXXXXXXXXXXXXXXXTCNNVN 206 LNDIGNLVTV GVDGKPQPQISRPITRSFC C N+N Sbjct: 41 LNDIGNLVTVNGVDGKPQPQISRPITRSFCAQLLANAQAAAENNKKQACVNMN 93 >XP_002283152.1 PREDICTED: G2/mitotic-specific cyclin S13-7 [Vitis vinifera] CBI32811.3 unnamed protein product, partial [Vitis vinifera] Length = 453 Score = 61.6 bits (148), Expect = 6e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVTV+GVDGKPQPQISRP+TRSFC Sbjct: 38 LGDIGNLVTVRGVDGKPQPQISRPVTRSFC 67 >BAA20413.1 B-type cyclin, partial [Catharanthus roseus] Length = 186 Score = 57.4 bits (137), Expect = 6e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVTV+GV+GKP PQ+SRPITRSFC Sbjct: 36 LGDIGNLVTVRGVEGKPLPQVSRPITRSFC 65 >BAA20411.1 B-type cyclin [Catharanthus roseus] Length = 436 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVTV+GV+GKP PQ+SRPITRSFC Sbjct: 36 LGDIGNLVTVRGVEGKPLPQVSRPITRSFC 65 >XP_011079084.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Sesamum indicum] Length = 442 Score = 56.2 bits (134), Expect = 4e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGN+VT++GVDGKP PQ+SRP+TRSFC Sbjct: 35 LGDIGNVVTLRGVDGKPLPQVSRPVTRSFC 64 >CAN73346.1 hypothetical protein VITISV_037918 [Vitis vinifera] Length = 451 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVT+ GVDGKPQPQISRPITR FC Sbjct: 39 LGDIGNLVTI-GVDGKPQPQISRPITRGFC 67 >CBI25451.3 unnamed protein product, partial [Vitis vinifera] Length = 462 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVT+ GVDGKPQPQISRPITR FC Sbjct: 39 LGDIGNLVTI-GVDGKPQPQISRPITRGFC 67 >XP_010658250.2 PREDICTED: G2/mitotic-specific cyclin S13-7 isoform X2 [Vitis vinifera] Length = 476 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVT+ GVDGKPQPQISRPITR FC Sbjct: 53 LGDIGNLVTI-GVDGKPQPQISRPITRGFC 81 >XP_002273378.2 PREDICTED: G2/mitotic-specific cyclin S13-7 isoform X1 [Vitis vinifera] Length = 479 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVT+ GVDGKPQPQISRPITR FC Sbjct: 56 LGDIGNLVTI-GVDGKPQPQISRPITRGFC 84 >XP_010271918.1 PREDICTED: G2/mitotic-specific cyclin S13-7-like [Nelumbo nucifera] Length = 461 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVTV+GV+GKPQ Q SRP TRSFC Sbjct: 35 LGDIGNLVTVRGVEGKPQQQFSRPATRSFC 64 >XP_012828105.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Erythranthe guttata] EYU18599.1 hypothetical protein MIMGU_mgv1a006297mg [Erythranthe guttata] Length = 449 Score = 53.5 bits (127), Expect = 4e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNLVT++G DGKP PQ+SRP+TR FC Sbjct: 36 LGDIGNLVTLRGPDGKPLPQVSRPVTRGFC 65 >CDP06215.1 unnamed protein product [Coffea canephora] Length = 454 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGN+VTV+ V+GKP PQISRP+TRSFC Sbjct: 35 LGDIGNMVTVRPVEGKPLPQISRPVTRSFC 64 >XP_015159582.1 PREDICTED: G2/mitotic-specific cyclin S13-7-like isoform X1 [Solanum tuberosum] Length = 446 Score = 52.8 bits (125), Expect = 7e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGNL T +GV+GKP PQ+SRP+TRSFC Sbjct: 37 LGDIGNLATGRGVEGKPLPQVSRPVTRSFC 66 >XP_011091938.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Sesamum indicum] Length = 446 Score = 52.8 bits (125), Expect = 7e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGN+VTV+GV+GK PQ+SRP+TRSFC Sbjct: 34 LGDIGNVVTVRGVEGKQLPQVSRPVTRSFC 63 >GAV92562.1 Cyclin_N domain-containing protein/Cyclin_C domain-containing protein [Cephalotus follicularis] Length = 466 Score = 52.8 bits (125), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKP-QPQISRPITRSFC 137 L DIGN++TV+G+DGKP QP ISRPITRSFC Sbjct: 41 LGDIGNVLTVRGIDGKPHQPNISRPITRSFC 71 >OMO53900.1 hypothetical protein CCACVL1_28253 [Corchorus capsularis] Length = 512 Score = 52.8 bits (125), Expect = 7e-06 Identities = 25/31 (80%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +3 Query: 48 LNDIGNLVTVKG-VDGKPQPQISRPITRSFC 137 L DIGNLV V+G VDGKPQPQI RP+TRSFC Sbjct: 79 LGDIGNLVNVRGAVDGKPQPQIHRPLTRSFC 109 >XP_011070091.1 PREDICTED: G2/mitotic-specific cyclin-1-like [Sesamum indicum] Length = 446 Score = 52.4 bits (124), Expect = 1e-05 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 48 LNDIGNLVTVKGVDGKPQPQISRPITRSFC 137 L DIGN+VTV+GV+GK PQ+SRP+TRSFC Sbjct: 34 LGDIGNVVTVRGVEGKQIPQVSRPVTRSFC 63