BLASTX nr result
ID: Phellodendron21_contig00020603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020603 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015385195.1 PREDICTED: golgin subfamily A member 4-like [Citr... 67 2e-10 XP_006439394.1 hypothetical protein CICLE_v10018618mg [Citrus cl... 65 6e-10 XP_011022541.1 PREDICTED: myosin-10-like [Populus euphratica] XP... 58 2e-07 XP_002303631.2 hypothetical protein POPTR_0003s13720g [Populus t... 58 2e-07 XP_006385792.1 hypothetical protein POPTR_0003s13720g [Populus t... 58 2e-07 OAY59623.1 hypothetical protein MANES_01G045900 [Manihot esculenta] 57 3e-07 XP_019422100.1 PREDICTED: intracellular protein transport protei... 57 3e-07 OIV94020.1 hypothetical protein TanjilG_19381 [Lupinus angustifo... 57 3e-07 XP_011026924.1 PREDICTED: putative protein tag-278 [Populus euph... 56 1e-06 XP_002299490.2 COP1-interactive protein 1 [Populus trichocarpa] ... 56 1e-06 XP_010104984.1 hypothetical protein L484_012068 [Morus notabilis... 55 2e-06 XP_016189418.1 PREDICTED: myosin heavy chain, skeletal muscle, a... 54 4e-06 XP_015955369.1 PREDICTED: intracellular protein transport protei... 54 4e-06 XP_018860551.1 PREDICTED: protein NETWORKED 1A-like [Juglans reg... 54 5e-06 XP_014508981.1 PREDICTED: putative leucine-rich repeat-containin... 54 5e-06 GAV63549.1 hypothetical protein CFOL_v3_07067, partial [Cephalot... 54 5e-06 XP_014508979.1 PREDICTED: myosin-3 isoform X1 [Vigna radiata var... 54 5e-06 XP_017184782.1 PREDICTED: protein NETWORKED 4B-like [Malus domes... 54 6e-06 XP_018815550.1 PREDICTED: myosin-11-like [Juglans regia] XP_0188... 54 7e-06 XP_008239065.1 PREDICTED: intracellular protein transport protei... 54 7e-06 >XP_015385195.1 PREDICTED: golgin subfamily A member 4-like [Citrus sinensis] Length = 1791 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLC+WIEYHR+RYDYLKEVLSK TV GRRAT Sbjct: 1758 AIRQLCVWIEYHRNRYDYLKEVLSKMTVTGRRAT 1791 >XP_006439394.1 hypothetical protein CICLE_v10018618mg [Citrus clementina] XP_006439395.1 hypothetical protein CICLE_v10018618mg [Citrus clementina] XP_006439396.1 hypothetical protein CICLE_v10018618mg [Citrus clementina] ESR52634.1 hypothetical protein CICLE_v10018618mg [Citrus clementina] ESR52635.1 hypothetical protein CICLE_v10018618mg [Citrus clementina] ESR52636.1 hypothetical protein CICLE_v10018618mg [Citrus clementina] Length = 1077 Score = 65.1 bits (157), Expect = 6e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLC+WIEYHR+RYDYLKEVLSK TV GRR T Sbjct: 1044 AIRQLCVWIEYHRNRYDYLKEVLSKMTVTGRRGT 1077 >XP_011022541.1 PREDICTED: myosin-10-like [Populus euphratica] XP_011022542.1 PREDICTED: myosin-10-like [Populus euphratica] XP_011022543.1 PREDICTED: myosin-10-like [Populus euphratica] XP_011022544.1 PREDICTED: myosin-10-like [Populus euphratica] Length = 1277 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLC+WIEYH+SRYDYL+E+LSK + G+RA+ Sbjct: 1244 AIRQLCIWIEYHQSRYDYLREMLSKMPIRGQRAS 1277 >XP_002303631.2 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] EEE78610.2 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] Length = 1698 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLC+WIEYH+SRYDYL+E+LSK + G+RA+ Sbjct: 1665 AIRQLCIWIEYHQSRYDYLREMLSKMPIRGQRAS 1698 >XP_006385792.1 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] XP_006385793.1 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] ERP63589.1 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] ERP63590.1 hypothetical protein POPTR_0003s13720g [Populus trichocarpa] Length = 1788 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLC+WIEYH+SRYDYL+E+LSK + G+RA+ Sbjct: 1755 AIRQLCIWIEYHQSRYDYLREMLSKMPIRGQRAS 1788 >OAY59623.1 hypothetical protein MANES_01G045900 [Manihot esculenta] Length = 867 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRA 241 AIRQLCLWI+YHRS YDYL+E+LSK V G RA Sbjct: 834 AIRQLCLWIDYHRSHYDYLREILSKMPVRGHRA 866 >XP_019422100.1 PREDICTED: intracellular protein transport protein USO1-like [Lupinus angustifolius] XP_019422101.1 PREDICTED: intracellular protein transport protein USO1-like [Lupinus angustifolius] Length = 1061 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRA 241 AIRQLCLWIEYHR RYDYLK++LS KT IG+RA Sbjct: 1029 AIRQLCLWIEYHRGRYDYLKDILS-KTRIGQRA 1060 >OIV94020.1 hypothetical protein TanjilG_19381 [Lupinus angustifolius] Length = 1121 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRA 241 AIRQLCLWIEYHR RYDYLK++LS KT IG+RA Sbjct: 1089 AIRQLCLWIEYHRGRYDYLKDILS-KTRIGQRA 1120 >XP_011026924.1 PREDICTED: putative protein tag-278 [Populus euphratica] XP_011026925.1 PREDICTED: putative protein tag-278 [Populus euphratica] XP_011026926.1 PREDICTED: putative protein tag-278 [Populus euphratica] XP_011026927.1 PREDICTED: putative protein tag-278 [Populus euphratica] Length = 1005 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLCLWIEYHRSR+DYL+E+LSK + +RA+ Sbjct: 972 AIRQLCLWIEYHRSRHDYLREMLSKMPIRSQRAS 1005 >XP_002299490.2 COP1-interactive protein 1 [Populus trichocarpa] EEE84295.2 COP1-interactive protein 1 [Populus trichocarpa] Length = 1096 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLCLWIEYHRSR+DYL+E+LSK + +RA+ Sbjct: 1063 AIRQLCLWIEYHRSRHDYLREMLSKMPIRSQRAS 1096 >XP_010104984.1 hypothetical protein L484_012068 [Morus notabilis] EXC02941.1 hypothetical protein L484_012068 [Morus notabilis] Length = 1808 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIG-RRAT 238 AIRQLCLWI+YHRSRYD LKEVLSK T + +RAT Sbjct: 1774 AIRQLCLWIDYHRSRYDNLKEVLSKTTTVRVQRAT 1808 >XP_016189418.1 PREDICTED: myosin heavy chain, skeletal muscle, adult [Arachis ipaensis] XP_016189419.1 PREDICTED: myosin heavy chain, skeletal muscle, adult [Arachis ipaensis] Length = 1275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSK 265 AIRQLCLWI+YHRSRYDYLK+VLSK Sbjct: 1243 AIRQLCLWIDYHRSRYDYLKDVLSK 1267 >XP_015955369.1 PREDICTED: intracellular protein transport protein USO1 [Arachis duranensis] XP_015955370.1 PREDICTED: intracellular protein transport protein USO1 [Arachis duranensis] XP_015955371.1 PREDICTED: intracellular protein transport protein USO1 [Arachis duranensis] Length = 1275 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSK 265 AIRQLCLWI+YHRSRYDYLK+VLSK Sbjct: 1243 AIRQLCLWIDYHRSRYDYLKDVLSK 1267 >XP_018860551.1 PREDICTED: protein NETWORKED 1A-like [Juglans regia] XP_018860552.1 PREDICTED: protein NETWORKED 1A-like [Juglans regia] XP_018860553.1 PREDICTED: protein NETWORKED 1A-like [Juglans regia] XP_018860554.1 PREDICTED: protein NETWORKED 1A-like [Juglans regia] XP_018860555.1 PREDICTED: protein NETWORKED 1A-like [Juglans regia] Length = 741 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRAT 238 AIRQLC+WI+YHRSR DY KE+LSK TV G+ A+ Sbjct: 708 AIRQLCVWIDYHRSRQDYFKEMLSKVTVRGQGAS 741 >XP_014508981.1 PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 isoform X2 [Vigna radiata var. radiata] Length = 1235 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 336 IRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRA 241 IRQLCLWI+YHRSRYDYLK++LS KT G+RA Sbjct: 1204 IRQLCLWIDYHRSRYDYLKDILS-KTRSGQRA 1234 >GAV63549.1 hypothetical protein CFOL_v3_07067, partial [Cephalotus follicularis] Length = 1310 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRR 244 AIRQLC+WIEYHR RYDY+KEVLSK V +R Sbjct: 1277 AIRQLCMWIEYHRDRYDYVKEVLSKIGVRAQR 1308 >XP_014508979.1 PREDICTED: myosin-3 isoform X1 [Vigna radiata var. radiata] XP_014508980.1 PREDICTED: myosin-3 isoform X1 [Vigna radiata var. radiata] Length = 1337 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 336 IRQLCLWIEYHRSRYDYLKEVLSKKTVIGRRA 241 IRQLCLWI+YHRSRYDYLK++LS KT G+RA Sbjct: 1306 IRQLCLWIDYHRSRYDYLKDILS-KTRSGQRA 1336 >XP_017184782.1 PREDICTED: protein NETWORKED 4B-like [Malus domestica] Length = 354 Score = 53.5 bits (127), Expect = 6e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKT 259 AIRQLC+WIEYH+SRYD+LKE+LSK T Sbjct: 315 AIRQLCIWIEYHQSRYDHLKEILSKTT 341 >XP_018815550.1 PREDICTED: myosin-11-like [Juglans regia] XP_018815551.1 PREDICTED: myosin-11-like [Juglans regia] Length = 1308 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKTVIGRR 244 AIRQLC+WI+YH SR DYLKE+LSK TV G+R Sbjct: 1275 AIRQLCVWIDYHSSRSDYLKEMLSKVTVRGQR 1306 >XP_008239065.1 PREDICTED: intracellular protein transport protein USO1 [Prunus mume] Length = 1380 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 339 AIRQLCLWIEYHRSRYDYLKEVLSKKT 259 AIRQLC+WIEYHRSRYD LKEVLSK T Sbjct: 1346 AIRQLCIWIEYHRSRYDDLKEVLSKMT 1372