BLASTX nr result
ID: Phellodendron21_contig00020550
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020550 (435 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006439550.1 hypothetical protein CICLE_v10019291mg [Citrus cl... 57 1e-06 KDO76215.1 hypothetical protein CISIN_1g006806mg [Citrus sinensis] 57 1e-06 XP_006439551.1 hypothetical protein CICLE_v10019291mg [Citrus cl... 57 1e-06 XP_006476575.2 PREDICTED: uncharacterized protein LOC102610276 [... 57 1e-06 >XP_006439550.1 hypothetical protein CICLE_v10019291mg [Citrus clementina] ESR52790.1 hypothetical protein CICLE_v10019291mg [Citrus clementina] Length = 585 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -3 Query: 433 KKSSEAYMPVFEAQRSFGKPKTEDSSD-SNAKKAE 332 KKSSEAYMPV EAQRSFGK KTE++SD SNAKKA+ Sbjct: 548 KKSSEAYMPVLEAQRSFGKSKTEENSDASNAKKAD 582 >KDO76215.1 hypothetical protein CISIN_1g006806mg [Citrus sinensis] Length = 630 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -3 Query: 433 KKSSEAYMPVFEAQRSFGKPKTEDSSD-SNAKKAE 332 KKSSEAYMPV EAQRSFGK KTE++SD SNAKKA+ Sbjct: 593 KKSSEAYMPVLEAQRSFGKSKTEENSDASNAKKAD 627 >XP_006439551.1 hypothetical protein CICLE_v10019291mg [Citrus clementina] ESR52791.1 hypothetical protein CICLE_v10019291mg [Citrus clementina] Length = 630 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -3 Query: 433 KKSSEAYMPVFEAQRSFGKPKTEDSSD-SNAKKAE 332 KKSSEAYMPV EAQRSFGK KTE++SD SNAKKA+ Sbjct: 593 KKSSEAYMPVLEAQRSFGKSKTEENSDASNAKKAD 627 >XP_006476575.2 PREDICTED: uncharacterized protein LOC102610276 [Citrus sinensis] Length = 1385 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -3 Query: 433 KKSSEAYMPVFEAQRSFGKPKTEDSSD-SNAKKAE 332 KKSSEAYMPV EAQRSFGK KTE++SD SNAKKA+ Sbjct: 593 KKSSEAYMPVLEAQRSFGKSKTEENSDASNAKKAD 627