BLASTX nr result
ID: Phellodendron21_contig00020342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020342 (557 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006469164.1 PREDICTED: extensin-like [Citrus sinensis] 56 1e-06 XP_006448276.1 hypothetical protein CICLE_v10017051mg [Citrus cl... 56 1e-06 >XP_006469164.1 PREDICTED: extensin-like [Citrus sinensis] Length = 155 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 99 RKPPHKTDDQSSAMTLGKSMVMVTAANVLVFVF 1 RKPPH+TD+QSSA + GKSM ++TAANVLVFVF Sbjct: 117 RKPPHQTDNQSSATSTGKSMALITAANVLVFVF 149 >XP_006448276.1 hypothetical protein CICLE_v10017051mg [Citrus clementina] ESR61516.1 hypothetical protein CICLE_v10017051mg [Citrus clementina] Length = 155 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 99 RKPPHKTDDQSSAMTLGKSMVMVTAANVLVFVF 1 RKPPH+TD+QSSA + GKSM ++TAANVLVFVF Sbjct: 117 RKPPHQTDNQSSATSTGKSMALITAANVLVFVF 149