BLASTX nr result
ID: Phellodendron21_contig00020320
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00020320 (540 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO47944.1 hypothetical protein CISIN_1g001512mg [Citrus sinensis] 86 3e-16 XP_006486963.1 PREDICTED: homeobox protein HAT3.1 [Citrus sinens... 86 3e-16 XP_006422879.1 hypothetical protein CICLE_v10027725mg [Citrus cl... 86 3e-16 >KDO47944.1 hypothetical protein CISIN_1g001512mg [Citrus sinensis] Length = 1063 Score = 85.9 bits (211), Expect = 3e-16 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = -1 Query: 540 ECDRSSKPTTQTSRKRNREGKLGNQASDRISKIEVVQGLPASSPKVEAQTNGQTRRKQNS 361 EC+ S KPT+QTSRKR+R+GK G+QASD SK+EV+QGL A+SPKVE Q NG+TRR++NS Sbjct: 1003 ECN-SIKPTSQTSRKRDRDGKSGDQASDPSSKMEVIQGLSANSPKVEVQANGRTRRRRNS 1061 Query: 360 AV 355 AV Sbjct: 1062 AV 1063 >XP_006486963.1 PREDICTED: homeobox protein HAT3.1 [Citrus sinensis] XP_006486964.1 PREDICTED: homeobox protein HAT3.1 [Citrus sinensis] Length = 1063 Score = 85.9 bits (211), Expect = 3e-16 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = -1 Query: 540 ECDRSSKPTTQTSRKRNREGKLGNQASDRISKIEVVQGLPASSPKVEAQTNGQTRRKQNS 361 EC+ S KPT+QTSRKR+R+GK G+QASD SK+EV+QGL A+SPKVE Q NG+TRR++NS Sbjct: 1003 ECN-SIKPTSQTSRKRDRDGKSGDQASDPSSKMEVIQGLSANSPKVEVQANGRTRRRRNS 1061 Query: 360 AV 355 AV Sbjct: 1062 AV 1063 >XP_006422879.1 hypothetical protein CICLE_v10027725mg [Citrus clementina] ESR36119.1 hypothetical protein CICLE_v10027725mg [Citrus clementina] Length = 1063 Score = 85.9 bits (211), Expect = 3e-16 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = -1 Query: 540 ECDRSSKPTTQTSRKRNREGKLGNQASDRISKIEVVQGLPASSPKVEAQTNGQTRRKQNS 361 EC+ S KPT+QTSRKR+R+GK G+QASD SK+EV+QGL A+SPKVE Q NG+TRR++NS Sbjct: 1003 ECN-SIKPTSQTSRKRDRDGKSGDQASDPSSKMEVIQGLSANSPKVEVQANGRTRRRRNS 1061 Query: 360 AV 355 AV Sbjct: 1062 AV 1063